Recombinant Escherichia coli K99 fimbrial protein (fanC)

In Stock
Code CSB-EP322992ENLe1
Abbreviation Recombinant E.coli fanC protein
MSDS
Size US$554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322992ENLe1 could indicate that this peptide derived from E.coli-expressed Escherichia coli fanC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP322992ENLe1 could indicate that this peptide derived from E.coli-expressed Escherichia coli fanC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
fanC
Uniprot No.
Research Area
others
Alternative Names
fanCK99 fimbrial protein
Species
Escherichia coli
Source
E.coli
Expression Region
23-181aa
Target Protein Sequence
NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CUSABIO synthesized the recombinant gene by integrating the Tag-Free sequence into the targeted gene encoding the 23-181aa of the Escherichia coli fanC. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the E.coli for expression. The product was purified to obtain the recombinant Escherichia coli fanC protein carrying Tag-Free. The SDS-PAGE assayed the purity of this recombinant fanC protein greater than 90%. This fanC protein migrated along the gel to a band of about 17 kDa molecular weight.

fanC is a gene providing instruction of making a protein named K99 fimbrial protein in E.coli and belongs to fimbrial protein family. K99 fimbrial protein is the fimbrial type F5 and specifically mediates the attachment of Enterotoxigenic Escherichia coli (ETEC) to mucosal surfaces of calves, lambs, and piglets. ETEC colonize in the intestine by means of specific adhesion factors (fimbriae) and produce en terotoxins resulting in gastric diseases. Production of K99 requires the expression of eight unique proteins: FanA–H. FanC,the major subunit and immunogenic polypeptide of K99 fimbriae is the most highly expressed of the K99 genes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

For protein: CSB-EP322992ENLe1 / RPC20557
However, I do have a question about the product. You say it comes in a buffer, but what does the buffer contains? I have looked for this protein with other suppliers as well and they all supply it lyophilized.
On your site it says expiry date: 12 months in lyophilized form; 6 months in solution form. This suggest it comes lyophilized?
Can you also provide me information about the suitability for MALDI-TOF MS? It is of high importance that I can use it for this technique because I want to determine the specific K99 peak.

A:
Very nice to receive your inquiry. Actually we have two lots of stock for this protein, one lot is Lyophilized Powder, and another lot is Liquid Form.
The shelf life of Lyophilized Powder is 12 months, and the shelf of Liquid Form is 6 months.
1. Product Details & Stock Info
Code: CSB-EP322992ENLe1
Name: Recombinant Escherichia coli K99 fimbrial protein(fanC)
Expression Region: 23-181aa; Full Length of Mature Protein
Tag Info: NO-tagged
Expression Sequence:

NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM


Product Type: Developed Recombiant Protein
1) Delivery Form: Lyophilized Powder
Buffer before Lyophilization: Lyophilized from a 0.2 μm filtered 10 mM Tris-HCl, 1 mM EDTA, pH 8.0
Endotoxin Removal: No
Aseptic Processing: No
Note: If your order size is 0.1mg *X, we could deliver Lyophilized Powder directly. If not, we suggest to deliver Liquid Form.
2) Delivery Form: Liquid
Storage Buffer: 100 mM Tris-HCl, 0.4M Arg, pH 8.0, 20% glycerol
Endotoxin Removal: No
Aseptic Processing: No
2. LC-MS Info
The LC-MS we currently perform is based on the theoretical sequence in the database and then spliced. You meant that you wanted to compare the actual peak map.
The positive control of mass spectrometry does not require much, as long as it can ensure that there is no problem with the protein, the sequencing is correct, or the mass spectrometry itself is also performed,
then it can be applied. The sequencing of our stock protein is correct, so it can be used in the your application in theory.
But to get the same peak map, two conditions need to be met: 1. There is no extra residual amino acid. 2. For post-translational modification, the structure is the same as the native protein.
1) Our no-tagged protein CSB-EP322992ENLe1 was obtained by Sumo enzyme digestion. There are several amino acid residues (GSEFRT) after the cleavage.
So the N-terminus of the spectrum is a little different. But it is no problem to make a qualitative judgment.
2) For this protein, itself is the E. coli 's own protein, structure is almost the same with the natural protein modification.

Target Background

Function
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae.
Subcellular Location
Fimbrium.
Protein Families
Fimbrial protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*