Code | CSB-EP322992ENLe1 |
Size | US$2632 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO synthesized the recombinant gene by integrating the Tag-Free sequence into the targeted gene encoding the 23-181aa of the Escherichia coli fanC. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the E.coli for expression. The product was purified to obtain the recombinant Escherichia coli fanC protein carrying Tag-Free. The SDS-PAGE assayed the purity of this recombinant fanC protein greater than 90%. This fanC protein migrated along the gel to a band of about 17 kDa molecular weight. fanC is a gene providing instruction of making a protein named K99 fimbrial protein in E.coli and belongs to fimbrial protein family. K99 fimbrial protein is the fimbrial type F5 and specifically mediates the attachment of Enterotoxigenic Escherichia coli (ETEC) to mucosal surfaces of calves, lambs, and piglets. ETEC colonize in the intestine by means of specific adhesion factors (fimbriae) and produce en terotoxins resulting in gastric diseases. Production of K99 requires the expression of eight unique proteins: FanA–H. FanC,the major subunit and immunogenic polypeptide of K99 fimbriae is the most highly expressed of the K99 genes. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | fanC |
Uniprot No. | P18103 |
Research Area | others |
Alternative Names |
fanCK99 fimbrial protein
|
Species | Escherichia coli |
Source | E.coli |
Expression Region | 23-181aa |
Target Protein Sequence | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 16.5kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
Tag-Free |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
For protein: CSB-EP322992ENLe1 / RPC20557
However, I do have a question about the product. You say it comes in a buffer, but what does the buffer contains? I have looked for this protein with other suppliers as well and they all supply it lyophilized.
On your site it says expiry date: 12 months in lyophilized form; 6 months in solution form. This suggest it comes lyophilized?
Can you also provide me information about the suitability for MALDI-TOF MS? It is of high importance that I can use it for this technique because I want to determine the specific K99 peak.
NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Function |
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae.
|
Subcellular Location | Fimbrium. |
Protein Families | Fimbrial protein family |