Recombinant Escherichia coli Major outer membrane lipoprotein Lpp (lpp)

In Stock
Code CSB-EP300885ENV
Abbreviation Recombinant E.coli lpp protein
MSDS
Size US$388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP300885ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) lpp.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP300885ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) lpp.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
lpp
Uniprot No.
Research Area
Signal Transduction
Alternative Names
lpp; mlpA; mulI; b1677; JW1667Major outer membrane lipoprotein Lpp; Braun lipoprotein; BLP; Murein-lipoprotein
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
21-78aa
Target Protein Sequence
CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
An outer membrane lipoprotein that controls the distance between the inner and outer membranes; adding residues to Lpp increases the width of the periplasm. The only protein known to be covalently linked to the peptidoglycan network (PGN). Also non-covalently binds the PGN. The link between the cell outer membrane and PGN contributes to the maintenance of the structural and functional integrity of the cell envelope, and maintains the correct distance between the PGN and the outer membrane. The most abundant cellular protein in terms of copy number, there can be up to one million Lpp molecules per cell. About one-third of Lpp is bound to the PGN (called bound or periplasmic) the rest is called free or transmembrane. The 'free' form can be surface labeled by membrane impermeable agents and so must cross the outer membrane; it is thought that this transmembrane form is still anchored in the inner leaflet of the outer membrane. Modeling suggests that non-covalent binding of OmpA (from the outer membrane) and TolR (from the inner membrane) to peptidoglycan maintains the position of the cell wall in the periplasm, holding it approximately equidistant from both the inner and outer membranes. Trimeric Lpp controls the width of the periplasm, adjusts its tilt angle to accommodate to the available space, and can compensate in part for an absence of OmpA (Probable). The role of the cell surface-exposed, free form (transmembrane) of Lpp is unknown.
Gene References into Functions
  1. Here, the authors demonstrate that a mutant variant of an outer-membrane lipoprotein, Lpp(+Leu), can function as a novel allosteric effector that changes the dynamic range of DegP activity. PMID: 28923470
  2. From this work, the authors conclude that outer membrane vesicles production can be driven by distinct Lpp concentration-dependent and Lpp concentration-independent pathways. PMID: 25528573
  3. The free and bound forms of Lpp are not largely associated with each other, but are found in distinct subcellular locations. PMID: 21219470
  4. The free form of Lpp is an integral outer membrane protein whose C-terminus is exposed on the cell surface. PMID: 21338414
  5. analysis of synthesis of cross-linked murein and its attachment to sacculi by PBP1A from Escherichia coli PMID: 16840781

Show More

Hide All

Subcellular Location
Cell outer membrane; Lipid-anchor; Periplasmic side. Secreted, cell wall; Peptidoglycan-anchor. Cell outer membrane; Lipid-anchor; Extracellular side.
Protein Families
Lpp family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*