Home
Protein
Recombinant Proteins
Recombinant Escherichia coli O6:H1 Cell division protein FtsZ (ftsZ)

Recombinant Escherichia coli O6:H1 Cell division protein FtsZ (ftsZ)

^{In Stock}

Code	CSB-EP359270EGX
Abbreviation	Recombinant E.coli O6:H1 ftsZ protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ftsZ

Uniprot No.

P0A9A7

Research Area

Others

Alternative Names

ftsZ; c0113Cell division protein FtsZ

Species

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Source

E.coli

Expression Region

1-383aa

Target Protein Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

56.3kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression of the recombinant Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) ftsZ protein involves the construction of a plasmid encoding the Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) ftsZ protein (1-383aa). This resulting plasmid is introduced into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. The protein is fused with a N-terminal 6xHis-SUMO tag. After that, cultured cells are lysed. The subsequent step includes purifying the recombinant Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) ftsZ protein through affinity purification from the cell lysate and assessing the purity of the protein via SDS-PAGE. The purity of the recombinant ftsZ protein is greater than 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.

Subcellular Location

Cytoplasm.

Protein Families

FtsZ family

Database Links

KEGG: ecc:c0113

STRING: 199310.c0113

Promotions