Recombinant Escherichia coli O157:H7 Protease 7(ompT)

In Stock
Code CSB-EP348292EOD(M)
Product Type Recombinant Protein
Size US$2466
Uniprot No. P58603
Relevance Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP348292EOD(M) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP348292EOD(M) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O157:H7
Purity Greater than 90% as determined by SDS-PAGE.
Sequence STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF
Research Area Microbiology
Source E.coli
Gene Names ompT
Protein Names OmptinOuter membrane protein 3BProtease AProtease VII
Expression Region 21-317aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 49.5 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues (By similarity).
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Peptidase A26 family
Database Links

KEGG: ece:Z1931

STRING: 155864.Z1931

Related Products

ompT Antibodies

ompT Antibodies for Escherichia coli O157:H7

ompT Proteins

ompT Proteins for Escherichia coli O157:H7

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.