Recombinant Escherichia coli Recombination protein RecR(recR)

In Stock
Code CSB-EP358976ENV
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0A7H6
Lead Time 3-7 business days
Relevance May play a role in DNA repair. It ses to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF
Research Area Others
Source E.coli
Gene Names recR
Protein Names Recommended name: Recombination protein RecR
Expression Region 1-201aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 38.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.
Protein Families RecR family
Database Links

KEGG: ecj:JW0461

STRING: 316385.ECDH10B_0428

Related Products

recR Antibodies

recR Antibodies for Escherichia coli (strain K12)

recR Proteins

recR Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.