Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

fimH

Uniprot No.

P08191

Research Area

Microbiology

Alternative Names

fimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

22-300aa

Target Protein Sequence

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The fusion tag C-terminal 6xHis tag gene was added to the gene sequence corresponding to the E.coli of the E.coli fimH protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transformed into the E.coli for expression. Following purification, the product is the recombinant E.coli fimH protein carrying C-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant fimH protein up to 85%. It had an apparent molecular weight of approximately 30 kDa. This recombinant fimH protein may be used in fimH-mediated microbiology research.

fimH is gene providing instructions for making a protein named Type 1 fimbrin D-mannose specific adhesin (abbreviated fimH) in E.coli and belongs to Fimbrial protein family. FimH can specifically bind to mannose and is the most common adhesion organ for E. coli and other intestinal bacteria. Mannose is common in oligosaccharide chains in mammalian proteins, including urinary plaque at the top of the urinary tract and bladder epithelium, basement membrane adhesion protein, CD48 molecule on rat macrophages, granulocyte membrane antigen, Leukocyte adhesion molecules CD11 and CD18, salivary proteins and glycoproteins in urethral mucus.

Target Background

Function

Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

Gene References into Functions

Conformational switch of the bacterial adhesin FimH in the absence of the regulatory domain. PMID: 29180452
Evolutionary fine-tuning of conformational ensembles in FimH during host-pathogen interactions. PMID: 28246638
A mutant missing the type 1 pilus-associated adhesin FimH displayed somewhat reduced persistence within the gut. PMID: 29311232
The authors demonstrated that FimH residues E50 and T53 are crucial for adhesion under flow conditions. PMID: 27816993
In the absence of tensile force, the FimH pilin domain allosterically accelerates spontaneous ligand dissociation from the FimH lectin domain by 100,000-fold. PMID: 26948702
mouse urothelium responds to the adhesion of type 1-fimbriated UPEC by activating dual ligand/receptor system, one between FimH adhesin and uroplakin Ia and another between lipopolysaccharide and Tlr4. PMID: 26549759
Luteolin decreased the attachment and invasion of UPEC in bladder epithelial cells down-regulating the expression of adhesin fimH gene PMID: 25051393
Data indicate that thiazolylaminomannosides prevented bacterial attachment to the gut by blocking the FimH bacterial adhesin. PMID: 23795713
New promising vaccine combinations based on the FliC antigen against urinary tract infections caused by uropathogenic Escherichia coli. PMID: 23220068
analyzed mutational patterns in the fimH gene of mucosa-associated E. coli strains isolated from IBD and non-IBD pediatric patients to investigate microevolution of this genetic trait; study found some FimH variants that seem to be more involved than others in evolution of inflammatory bowel disease pathogenesis PMID: 22290143
FimH elicits an immune response that enhances cell adhesion of Escherichia coli. PMID: 21768279
Study presents the crystal structure of FimH incorporated into the multiprotein fimbrial tip, where the anchoring (pilin) domain of FimH interacts with the mannose-binding (lectin) domain and causes a twist in the beta sandwich fold of the latter. PMID: 20478255
Co-immunoprecipitation experiments in the presence of alpha-methyl mannose verified the binding of Escherichia coli FimH to ATP synthase beta-subunit of human brain microvascular endothelial cells. PMID: 20067530
the single A62S mutation altered phase variation, reducing the proportion of piliated cells, reduced mannose binding 8-fold, and decreased bladder colonization 30-fold in vivo compared to wild-type PMID: 20018753
FimH adhesin activated the murine microglial cell line, BV-2, which resulted in the production of nitric oxide and the release of tumor necrosis factor-alpha. PMID: 16036224
analysis of trimannose versus monomannose interactions with the FimH adhesin of Escherichia coli PMID: 16624825
Stability of the FimH-mannose bond. PMID: 16933977
findings indicate that FimH induces host cell signalling cascades that are involved in E. coli K1 invasion of human brain microvascular endothelial cells (HBMEC) and CD48 is a putative HBMEC receptor for FimH PMID: 17222190
Functional trade-offs may determine the natural populational instability of this mutation or other pathoadaptive FimH mutations that confer dramatic increases in 1M binding strength. PMID: 17502398
analysis of how interdomain interactions in the FimH adhesin of Escherichia coli regulate the affinity to mannose PMID: 17567583
Data show that removal of the cysteine bond in the mannose-binding domain of FimH did not affect FimH-mannose binding under static or low shear conditions, but the adhesion level was substantially decreased under increased fluid flow. PMID: 17697252
integrin-like allosteric link between the binding pocket and the interdomain conformation can serve as the basis for the catch bond property of FimH and, possibly, other adhesive proteins. PMID: 18174167
Deletion of fimH resulted in lost of agglutination ability. PMID: 18438011
Naturally occurring mutations in the signal peptides of the adhesive, tip-associated subunit of type 1 fimbriae (FimH) are positively selected in uropathogenic Escherichia coli. PMID: 18664574
The authors show by cryo-electron microscopy that FimH binding to the extracellular domain of UP Ia induces global conformational changes in the entire UP receptor complex, including a coordinated movement of the tightly bundled transmembrane helices. PMID: 19577575

Hide All

Subcellular Location

Fimbrium.

Protein Families

Fimbrial protein family

Database Links

KEGG: ecj:JW4283

STRING: 316407.85677063

Code	CSB-EP362349ENVc7
Abbreviation	Recombinant E.coli fimH protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage