Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
fimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH
Species
Escherichia coli (strain K12)
Expression Region
22-300aa
Target Protein Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The fusion tag C-terminal 6xHis tag gene was added to the gene sequence corresponding to the E.coli of the E.coli fimH protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transformed into the E.coli for expression. Following purification, the product is the recombinant E.coli fimH protein carrying C-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant fimH protein up to 85%. It had an apparent molecular weight of approximately 30 kDa. This recombinant fimH protein may be used in fimH-mediated microbiology research.
fimH is gene providing instructions for making a protein named Type 1 fimbrin D-mannose specific adhesin (abbreviated fimH) in E.coli and belongs to Fimbrial protein family. FimH can specifically bind to mannose and is the most common adhesion organ for E. coli and other intestinal bacteria. Mannose is common in oligosaccharide chains in mammalian proteins, including urinary plaque at the top of the urinary tract and bladder epithelium, basement membrane adhesion protein, CD48 molecule on rat macrophages, granulocyte membrane antigen, Leukocyte adhesion molecules CD11 and CD18, salivary proteins and glycoproteins in urethral mucus.