Code | CSB-EP362349ENV |
Abbreviation | Recombinant E.coli fimH protein |
MSDS | |
Size | US$388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I need the product to present guaranteed biological activity. FimH by itself is very sensitive, and out of what I have read it is highly unstable and lacks structure if not expressed along with FimC (its chaperone, Uniprot Q14F28).
Could you please inform me whether your product is at least expressed along with the FimC chaperone, thus conserves its native structure?
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
KEGG: ecj:JW4283
STRING: 316407.85677063