Recombinant Guinea pig Saposin-C(PSAP)

Code CSB-YP018836GU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P20097
Relevance Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Co-beta-glucosidaseGlucosylceramidase activatorSphingolipid activator protein 2 ;SAP-2
Species Cavia porcellus (Guinea pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG
Research Area Metabolism
Source Yeast
Gene Names PSAP
Protein Names Recommended name: Saposin-C Alternative name(s): Co-beta-glucosidase Glucosylceramidase activator Sphingolipid activator protein 2 Short name= SAP-2
Expression Region 1-81aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.
Database Links

STRING: 10141.ENSCPOP00000001595

Related Products

PSAP Proteins

PSAP Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.