Recombinant Human [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial (PDK1)

In Stock
Code CSB-EP613584HU
Abbreviation Recombinant Human PDK1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
acetyl-transferring;Pyruvate dehydrogenase kinase isoform 1;PDH kinase 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-436aa
Target Protein Sequence
SSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.
Gene References into Functions
  1. miR-375 and its probable PDK1 target may be utilized for the management of Kidney cancer. PMID: 30098579
  2. The importance of PDK1 in tumor growth and progression.A role of PDK1 in tumor microenvironment.[review] PMID: 28473254
  3. MiR-138 inhibits glycolysis but promotes mitochondrial respiration through directly targetting PDK1, and that contributes to cardiac cells' survival. PMID: 28899927
  4. Study shows higher expression level of PDK1 in non-small cell lung cancer (NSCLC) and its promoter region targeted by miR- 145. PMID: 28661070
  5. These results indicate that the immunohistochemistry analysis of the protein expression of PDK1, PHD3, and HIF-1alpha defines the hypoxic status of Neuroblastoma tumors. PMID: 29117193
  6. The pyruvate dehydrogenase kinases (PDKs) PDK1 and PDK3 are direct targets of KDM4A and E2F1 and modulate the switch between glycolytic metabolism and mitochondrial oxidation. PMID: 27626669
  7. dicumarol potently inhibited the kinase activity of PDK1, shifted the glucose metabolism from aerobic glycolysis to oxidative phosphorylation, generated a higher level of reactive oxygen species (ROS), attenuated the mitochondrial membrane potential (MMP), induced apoptosis, and reduced cell viability in vitro. PMID: 28617852
  8. miR-379 could function as a tumour-suppressing miRNA via targeting PDK1 in osteosarcoma. PMID: 27781416
  9. These results also suggest that inhibition of HIF-1a with 2-MeOE2 sensitizes radioresistant melanoma cells 435R to X-ray irradiation through targeting the glycolysis that is regulated by PDK1 PMID: 28339028
  10. PDK1 is frequently upregulated in primary nasopharyngeal carcinoma and may serve as a prognostic marker. PMID: 28029432
  11. A new function for PDK1 in metabolic reprogramming, which could be used to indicate the prognosis of Non small cell lung cancer and provide targeted therapeutic strategy for clinical treatment. PMID: 27878287
  12. Our results demonstrated that down-regulation of SDHB and up-regulation of PDK1 may be novel biomarkers for predicting advanced tumor progression and unfavorable prognosis in recurrent nasopharyngeal carcinoma patients PMID: 26547584
  13. n the conditon of miR- 128b over-expression, we also observed spontaneous inactivation of the Akt/NF-kappaB signalling, implying PDK1 was a potential regulator of this pathway. In conclusion, our study shed some novel light on miR-128b-PDK1/Akt/NF-kappaB axis onGastric cancer (GC) progression PMID: 26949090
  14. Dichloroacetate, an Iihibitor of PDK1, can reverse the mitochondrial suppression of renal cell carcinoma and decrease HIF transcriptional activity, decreasing tumor growth and angiogenesis. PMID: 26433571
  15. Tergeting PDK1 with dichloroacetophenone inhibited acute myeloid leukemia cell growth via multiple signaling pathways. PMID: 26593251
  16. PDK1 was specifically required for metabolic adaptation to nutrient limitation and hypoxia. PMID: 26365179
  17. High expression of PDK1 is associated with Colon Cancer. PMID: 26439504
  18. both PDK 1 and 2 isoforms are overexpressed in cutaneous melanoma compared to nevi, this expression being associated with the expression of the mTOR pathway effectors and independent of the BRAF mutational status PMID: 25976231
  19. Lin28A and Lin28B enhance, whereas let-7 suppresses, aerobic glycolysis via targeting pyruvate dehydrogenase kinase 1, or PDK1. PMID: 25301052
  20. Follow-up replication analyses in up to an additional 21,345 participants identified three new fasting plasma glucose loci reaching genome-wide significance in or near PDK1-RAPGEF4, KANK1, and IGF1R. PMID: 25187374
  21. NOR1 expression causes apoptosis of tumor cells in hypoxia by altering the expression of PDK1 expression and mitochondrial Bax-Bcl2 balance thus suppress tumor cell adaptation to hypoxia PMID: 24788728
  22. Accordingly, elevated levels of PDK1, PDK3, and PKM2 and reduced PK activity could be observed in iPSCs and human embryonic stem cells in the undifferentiated state PMID: 24123565
  23. High expression of pyruvate dehydrogenase kinase-1 is associated with gastric cancer. PMID: 23135628
  24. post-mortem brain extracts from patients with Alzheimer disease exhibited a decrease in PDK1 expression compared with nondemented patients. PMID: 22948140
  25. Pyruvate dehydrogenase kinase 1 is an important regulator of pyruvate dehydrogenase in clonal pancreatic beta-cells. PMID: 20415663
  26. mRNA levels not changed in skeletal muscle during fasting PMID: 14966024
  27. In summary, PDK activity is decreased after a high-fat diet that is rich in n-3 fatty acids, although PDHa activity was unaltered. PMID: 15591305
  28. HIF-1 also actively suppresses metabolism through the tricarboxylic acid cycle (TCA) by directly trans-activating the gene encoding pyruvate dehydrogenase kinase 1 (PDK1). PMID: 16517405
  29. Distinct structural mechanisms for inhibition of PDK1 by AZD7545, dichloroacetate, and radicol. PMID: 17683942
  30. HIF regulation of PDK-1 has a key role in maintaining lactate production in human cancer and that the investigation of PDK-1 inhibitors should be investigated for antitumour effects PMID: 18542064
  31. Data show that PDK1 and HIF prolyl hydroxylase 3 expressions are lowest in children of chronic mountain sickness fathers at altitude. PMID: 18954447

Show More

Hide All

Subcellular Location
Mitochondrion matrix.
Protein Families
PDK/BCKDK protein kinase family
Tissue Specificity
Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.
Database Links

HGNC: 8809

OMIM: 602524

KEGG: hsa:5163

STRING: 9606.ENSP00000282077

UniGene: Hs.470633

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*