Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah
Species
Homo sapiens (Human)
Expression Region
4-246aa
Target Protein Sequence
REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Explore the potential of our Recombinant Human YWHAH protein, a critical component in signal transduction research. This protein is a partial variant of the 14-3-3 protein eta (Protein AS1) and is derived from the 4-246aa expression region of the human YWHAH gene.
Sourced from E.coli, the protein comes with an N-terminal GST tag to facilitate purification and detection. Presented as a lyophilized powder, this Recombinant Human YWHAH protein boasts a purity of greater than 90% as determined by SDS-PAGE, ensuring reliable performance in your research endeavors.
