Home
Protein
Recombinant Proteins
Recombinant Human 14-3-3 protein eta (YWHAH), partial

Recombinant Human 14-3-3 protein eta (YWHAH), partial

^{In Stock}

Code	CSB-RP021744h
Abbreviation	Recombinant Human YWHAH protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP021744h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) YWHAH. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP021744h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) YWHAH.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

YWHAH

Uniprot No.

Q04917

Research Area

Signal Transduction

Alternative Names

14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

4-246aa

Target Protein Sequence

REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

54.9kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the potential of our Recombinant Human YWHAH protein, a critical component in signal transduction research. This protein is a partial variant of the 14-3-3 protein eta (Protein AS1) and is derived from the 4-246aa expression region of the human YWHAH gene.

Sourced from E.coli, the protein comes with an N-terminal GST tag to facilitate purification and detection. Presented as a lyophilized powder, this Recombinant Human YWHAH protein boasts a purity of greater than 90% as determined by SDS-PAGE, ensuring reliable performance in your research endeavors.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.

Gene References into Functions

Results show that YWHAZ amplification indicates a better survival trend in bladder cancer. Its knockdown promotes both in vitro and in vivo tumorigenesis in bladder cancer and may be a novel biomarker for bladder cancer. PMID: 29512774
The impact of AKT1 on glucocorticoid receptor (GR)-induced transcriptional activity in cooperation with phospho-serine/threonine-binding protein 14-3-3, was examined. PMID: 27717743
14-3-3 eta isoform colocalizes TDP-43 on the coarse granules in the anterior horn cells of patients with sporadic amyotrophic lateral sclerosis. PMID: 27256400
Extracellular 14-3-3eta activates key signalling cascades and induces factors associated with the pathogenesis of rheumatoid arthritis PMID: 24751211
This study identified YWHAH significantly associated loci with a biologically plausible role in schizophrenia. PMID: 24507884
14-3-3eta may be required for mitotic progression and may be considered as a novel anti-cancer strategy in combination with microtubule inhibitors. PMID: 22562251
This is the first genetic association study of YWHAH with sporadic Creutzfeldt-Jakob disease populations. PMID: 21739144
relocation of p33ING1b from the nucleus to the cytoplasm, where the protein is tethered by 14-3-3eta, participates in tumorigenesis and progression in HNSCC PMID: 21432775
The 14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma PMID: 20388496
phosphorylation of 14-3-3 binding site of myeloid leukemia factor 1 by MADM PMID: 12176995
Data demonstrate that 14-3-3 proteins are colocalized with Lewy bodies in Parkinson disease, but there was no specific staining for the 14-3-3 eta subunit. PMID: 12480176
gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein PMID: 16545136
The association of YWHAH with bipolar disorder in a large sample, consisting of 1211 subjects from 318 nuclear families including 554 affected offspring, was investigated. PMID: 19160447