Recombinant Human 14-3-3 protein eta(YWHAH),partial

In Stock
Code CSB-RP021744h
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP021744h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) YWHAH.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP021744h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) YWHAH.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names YWHAH
Uniprot No. Q04917
Research Area Signal Transduction
Alternative Names 14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah
Species Homo sapiens (Human)
Source E.coli
Expression Region 4-246aa
Target Protein Sequence REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 54.9kDa
Protein Length Partial
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Gene References into Functions
  1. Results show that YWHAZ amplification indicates a better survival trend in bladder cancer. Its knockdown promotes both in vitro and in vivo tumorigenesis in bladder cancer and may be a novel biomarker for bladder cancer. PMID: 29512774
  2. The impact of AKT1 on glucocorticoid receptor (GR)-induced transcriptional activity in cooperation with phospho-serine/threonine-binding protein 14-3-3, was examined. PMID: 27717743
  3. 14-3-3 eta isoform colocalizes TDP-43 on the coarse granules in the anterior horn cells of patients with sporadic amyotrophic lateral sclerosis. PMID: 27256400
  4. Extracellular 14-3-3eta activates key signalling cascades and induces factors associated with the pathogenesis of rheumatoid arthritis PMID: 24751211
  5. This study identified YWHAH significantly associated loci with a biologically plausible role in schizophrenia. PMID: 24507884
  6. 14-3-3eta may be required for mitotic progression and may be considered as a novel anti-cancer strategy in combination with microtubule inhibitors. PMID: 22562251
  7. This is the first genetic association study of YWHAH with sporadic Creutzfeldt-Jakob disease populations. PMID: 21739144
  8. relocation of p33ING1b from the nucleus to the cytoplasm, where the protein is tethered by 14-3-3eta, participates in tumorigenesis and progression in HNSCC PMID: 21432775
  9. The 14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma PMID: 20388496
  10. phosphorylation of 14-3-3 binding site of myeloid leukemia factor 1 by MADM PMID: 12176995
  11. Data demonstrate that 14-3-3 proteins are colocalized with Lewy bodies in Parkinson disease, but there was no specific staining for the 14-3-3 eta subunit. PMID: 12480176
  12. gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein PMID: 16545136
  13. The association of YWHAH with bipolar disorder in a large sample, consisting of 1211 subjects from 318 nuclear families including 554 affected offspring, was investigated. PMID: 19160447

Show More

Hide All

Protein Families 14-3-3 family
Tissue Specificity Expressed mainly in the brain and present in other tissues albeit at lower levels.
Database Links

HGNC: 12853

OMIM: 113508

KEGG: hsa:7533

STRING: 9606.ENSP00000248975

UniGene: Hs.226755

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1