Recombinant Human 2-5A-dependent ribonuclease (RNASEL)

Code CSB-YP313223HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP313223HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP313223HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP313223HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
2 5A dependent ribonuclease; 2 5A dependent RNase; 2' 5' oligoisoadenylate synthetase dependent; 2-5A-dependent ribonuclease; 2-5A-dependent RNase; DKFZp781D08126; Interferon induced 2 5A dependent RNase; MGC104972; MGC133329; PRCA 1; PRCA1; Ribonuclease 4; Ribonuclease L (2' 5' oligoisoadenylate synthetase dependent) ; Ribonuclease L; Ribonuclease4; RibonucleaseL; RN5A_HUMAN; RNase L; Rnasel; RNS 4; RNS4
Species
Homo sapiens (Human)
Expression Region
1-741
Target Protein Sequence
MESRDHNNPQ EGPTSSSGRR AAVEDNHLLI KAVQNEDVDL VQQLLEGGAN VNFQEEEGGW TPLHNAVQMS REDIVELLLR HGADPVLRKK NGATPFILAA IAGSVKLLKL FLSKGADVNE CDFYGFTAFM EAAVYGKVKA LKFLYKRGAN VNLRRKTKED QERLRKGGAT ALMDAAEKGH VEVLKILLDE MGADVNACDN MGRNALIHAL LSSDDSDVEA ITHLLLDHGA DVNVRGERGK TPLILAVEKK HLGLVQRLLE QEHIEINDTD SDGKTALLLA VELKLKKIAE LLCKRGASTD CGDLVMTARR NYDHSLVKVL LSHGAKEDFH PPAEDWKPQS SHWGAALKDL HRIYRPMIGK LKFFIDEKYK IADTSEGGIY LGFYEKQEVA VKTFCEGSPR AQREVSCLQS SRENSHLVTF YGSESHRGHL FVCVTLCEQT LEACLDVHRG EDVENEEDEF ARNVLSSIFK AVQELHLSCG YTHQDLQPQN ILIDSKKAAH LADFDKSIKW AGDPQEVKRD LEDLGRLVLY VVKKGSISFE DLKAQSNEEV VQLSPDEETK DLIHRLFHPG EHVRDCLSDL LGHPFFWTWE SRYRTLRNVG NESDIKTRKS ESEILRLLQP GPSEHSKSFD KWTTKINECV MKKMNKFYEK RGNFYQNTVG DLLKFIRNLG EHIDEEKHKK MKLKIGDPSL YFQKTFPDLV IYVYTKLQNT EYRKHFPQTH SPNKPQCDGA GGASGLASPG C
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

CSB-EP313223 (F2) protein was consulted. Can this protein be used as a standard product for ELisa kit? Another question is, is this protein full-length?

A:
Very nice to receive your inquiry. The details and distributor prices are as below.
1. Code: CSB-EP313223(F2)
Name: Recombinant Human 2-5A-dependent ribonuclease(RNASEL),partial
Expression Region: 330-741aa, partial
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC


Lead Time: We have 0..8mg inventory for this protein. If your order quantity is smaller than 0.8mg, the lead time will be 3-7 working days (once passing QC). If your order quantity is larger than 0.8mg, then the lead time will be 15-20 working days. This can be used in ELISA experiments or as a standard product, but the specific parameters still need to be explored.
2. We could provide full-length protein. The distributor prices are as below.
Recombinant Human 2-5A-dependent ribonuclease(RNASEL),full length protein
CSB-YP313223HU
CSB-EP313223HU
CSB-BP313223HU
CSB-MP313223HU
Tag Info: EP, BP, MP: N-terminal 10xHis-tag and C-terminal Myc-tag; YP: N-terminal 6xHis-tag
Expression Region: 1-741aa,full length
Target Protein Sequence:

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC

Target Background

Function
Endoribonuclease that functions in the interferon (IFN) antiviral response. In INF treated and virus infected cells, RNASEL probably mediates its antiviral effects through a combination of direct cleavage of single-stranded viral RNAs, inhibition of protein synthesis through the degradation of rRNA, induction of apoptosis, and induction of other antiviral genes. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. Therefore, activation of RNASEL could lead to elimination of virus infected cells under some circumstances. In the crosstalk between autophagy and apoptosis proposed to induce autophagy as an early stress response to small double-stranded RNA and at later stages of prolonged stress to activate caspase-dependent proteolytic cleavage of BECN1 to terminate autophagy and promote apoptosis. Might play a central role in the regulation of mRNA turnover. Cleaves 3' of UpNp dimers, with preference for UU and UA sequences, to sets of discrete products ranging from between 4 and 22 nucleotides in length.
Gene References into Functions
  1. Mitochondrial C11orf83 is a potent antiviral protein independent of interferon production; and knockdown of either OAS3 or RNase L impaired the antiviral capability of C11orf83. PMID: 28418037
  2. Our study suggests that RNASEL:p.Glu265* may be a genetic modifier of risk for early-onset breast cancer predisposition in carriers of high-risk mutations. PMID: 29422015
  3. Results reported in the present study suggest a sex-specific interaction between miR-146a and RNASEL genes in melanoma skin cancer susceptibility. PMID: 28654546
  4. These results demonstrate that ablation of RNase L activity promotes survival of ADAR1 deficient cells even in the presence of MDA5 and MAVS, suggesting that the RNase L system is the primary sensor pathway for endogenous dsRNA that leads to cell death. PMID: 28362255
  5. Mutations in the genes glucokinase regulatory protein (GCKR), RNase L (RNASEL), leukocyte immunoglobulin-like receptor 3 (LILRA3), and dynein axonemal heavy chain 10 (DNAH10) segregated with elevated HDLc levels in families, while no mutations associated with low HDLc. PMID: 24891332
  6. findings suggest that beside the RLR pathway, RNase L cleavage products can also activate the NLRP3-inflammasome pathway, which requires DHX33 (DExD/H-box helicase) and the mitochondrial adaptor protein MAVS. PMID: 26987611
  7. This study provides the evidence that germline variations in RNASEL are associated with fatal PCa in men (Gleason score >7 for rs486907 and RNASEL underexpressed [P = 0.007] in patients with PCa). PMID: 27318894
  8. By sequencing abundant RNA fragments generated by RNase L in cell lines, we identify site-specific cleavage of two groups of noncoding RNAs: Y-RNAs, whose function is poorly understood, and cytosolic tRNAs, which are essential for translation. PMID: 28808124
  9. RNASEL rs3738579 genotype was significantly related to severe necroinflammatory activity (NIA) grade of chronic hepatitis C patients. PMID: 28704535
  10. Serum RNase-L levels were inversely associated with metabolic syndrome and age. PMID: 28399925
  11. We show that mutations in RNase L found in HPC patients may promote prostate cancer by increasing expression of AR-responsive genes and cell motility and identify novel roles of RNase L as a prostate cancer susceptibility gene. PMID: 28257035
  12. Suggest that naturally occurring mutations in the RNase L gene might promote enhanced prostate cancer cell migration and metastasis. PMID: 26517238
  13. This review outlines the role of RNase-L in antimicrobial immunity and the cytoskeleton-associated innate response. [review] PMID: 26760998
  14. Data show that RNA decay by ribonuclease L (RNase L) has an important role in homeostasis and serves as a suppressor of cell adhesion. PMID: 26668391
  15. Single Nucleotide Polymorphisms in RNASEL involved in the immune response are generally not associated with intraprostatic inflammation in men without a Prostate cancer diagnosis. PMID: 26771888
  16. OAS3 displayed a higher affinity for dsRNA in intact cells than either OAS1 or OAS2, consistent with its dominant role in RNase L activation. PMID: 26858407
  17. Tanslation of vaccinia virus A27L and B5R genes is independent of PKR activation, but their expression is dependent on the RNase L activity. PMID: 26656695
  18. Our results demonstrate a novel role of RNase L generated small RNAs in cross-talk between autophagy and apoptosis that impacts the fate of cells during viral infections and cancer. PMID: 26263979
  19. Among 794 RNASEL Ssingle nucleotide polymorphism (SNPs) entries 124 SNPs were found nonsynonymous (ns) from which SIFT predicted 13 nsSNPs as nontolerable whereas PolyPhen-2 predicted 28. PMID: 26236721
  20. Virus infection and RNase L activation disrupt its association with Filamin A and release RNase L to mediate its canonical nuclease-dependent antiviral activities. PMID: 25352621
  21. These data show that RNase L targets specific sites in both host and viral RNAs to restrict influenza virus replication when NS1 protein is disabled. PMID: 25540362
  22. The IFNs inhibit viral infections in part through the 2',5'-oligoadenylate (2-5A) synthetase (OAS)/RNase L pathway. PMID: 24905202
  23. a model of feedback regulation in which RNase L and TTP target SRF mRNA and SRF-induced transcripts. PMID: 25301952
  24. data suggest that RNASEL, an enzyme involved in RNA turnover, is controlled by miR-146a and may be important in NMSC etiology PMID: 24699816
  25. The combined high affinity for double-stranded RNA and the capability to produce 2'-5'-linked oligoadenylates of sufficient length to activate RNase L suggests that OAS3 is a potent activator of RNase L. PMID: 25275129
  26. This study identified three RNASEL variants that are associated with risk for prostate cancer. PMID: 21360564
  27. RNAse L gene SNP 1385G>A does not have a clear clinical significance in CHC. PMID: 25286525
  28. RNase L activity limits FFA/obesity-induced impairment of insulin response in muscle cells via TLR3 and MnSOD expression. PMID: 24651439
  29. This work identifies novel roles for IFN-beta and RNase L in cell barrier functions that are targeted by bacterial effectors to escape host defense mechanisms and promote virulence. PMID: 24733098
  30. Association between SNPs from RNASEL and chromosome 8q24 with the risk of prostate cancer, and its aggressiveness, in a Hispanic (Chilean) population. PMID: 24224612
  31. this study reports 2.8 and 2.1 angstrom crystal structures of human RNase L in complexes with synthetic and natural ligands and a fragment of an RNA substrate. PMID: 24578532
  32. We show an association between RNASEL SNP rs12757998 and outcome after radiation therapy for prostate cancer PMID: 23382116
  33. the structural changes of human RNase L as a result of interactions with four different activators: natural 2-5 pA(4) and three tetramers with 3'-end AMP PMID: 22691533
  34. Data show that miR-29 acts via 4 target sites within the RNASEL 3' UTR. PMID: 23113544
  35. RNASEL mutations are associated with xenotropic murine leukemia virus and its R426Q polymorphism in patients with prostate cancer PMID: 23098452
  36. Two molecules of 2-5A at a time tether RNase L monomers via the ankyrin-repeat (ANK) domain. Each ANK domain harbors two distinct sites for 2-5A recognition that reside 50 A apart. PMID: 23084743
  37. among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV PMID: 23196181
  38. RNase L induces autophagy via c-Jun N-terminal kinase and double-stranded RNA-dependent protein kinase signaling pathways. PMID: 23109342
  39. study found that RNase L is highly expressed in lung cancer cells with significantly decreased enzymatic activity due to an increase of RLI, a specific inhibitor of RNase L PMID: 22925698
  40. Positive selection has operated on the RNASEL gene. PMID: 22513284
  41. Statistically significant differences were found between controls and patients in some of the genotyped regions of the RNASEL gene PMID: 22464196
  42. genotypes associated with the worst prognoses in prostate cancer are G/G in D541E, A/A in R462Q and A/G in I97L. PMID: 22083266
  43. The RNASEL 541Gln allele might be a low-penetrent risk factor for sporadic prostate cancer. PMID: 21656378
  44. Five SNPs were validated as being significantly associated with prostate cancer mortality, one each in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes. PMID: 21846818
  45. The RNASEL -1385G/A polymorphism is associated with cancer risk in African descendents. PMID: 21221811
  46. Ribonuclease L (RNASEL) protein was shown to be up-regulated in lopinavir-treated SiHa cells, which was confirmed by PCR and western blot. Targeted silencing of RNASEL reduced the sensitivity of SiHa cells to lopinavir. PMID: 21685539
  47. Codon 462 polymorphisms within the RNASEL gene are not associated with an increased risk of cervical cancer. PMID: 21665181
  48. Data show that the IQ motif-containing Ras GTPase-activating-like protein 1 (IQGAP1) can associate with RNase L, and that phosphorylation occurs on the IQGAP1, and works as a regulator in apoptosis. PMID: 20875083
  49. Genetic variation is associated with RNASEL associated with prostate cancer. PMID: 20576793
  50. These studies suggest that the expression of Xpr1 and certain genotypes of the RNASEL gene, which could restrict XMRV infection, may play important roles in defining XMRV tropisms in certain cell types. PMID: 20410264

Show More

Hide All

Involvement in disease
Prostate cancer, hereditary, 1 (HPC1)
Subcellular Location
Cytoplasm. Mitochondrion.
Protein Families
Protein kinase superfamily
Tissue Specificity
Highly expressed in spleen and thymus followed by prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes.
Database Links

HGNC: 10050

OMIM: 176807

KEGG: hsa:6041

STRING: 9606.ENSP00000356530

UniGene: Hs.518545

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1