Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2), partial

In Stock
Code CSB-EP010782HU1
Abbreviation Recombinant Human HSD3B2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HSD3B2
Uniprot No.
Research Area
Cancer
Alternative Names
3-beta-HSD II;3-beta-HSD adrenal and gonadal type;3-beta-hydroxy-5-ene steroid dehydrogenase;Progesterone reductase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-286aa
Target Protein Sequence
MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.9
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Gene References into Functions
  1. Independent silencing of CRY1 and CRY2 genes in HAC15 cells resulted in a mild upregulation of HSD3B2 without affecting HSD3B1 expression. In conclusion, our results support the hypothesis that CRY1 and CRY2, being AngII-regulated genes, and showing a differential expression in APAs when compared with the adjacent adrenal cortex, might be involved in adrenal cell function, and in the regulation of aldosterone production PMID: 29874863
  2. Observed significant increase in HSD3B2 and ESR1 transcripts in follicular eutropic endometrium from infertile women with endometriosis may be related to abnormal biological effect of E2 in endometrium, further affecting the development of human embryos. PMID: 29664547
  3. Sequencing analyses indicate homozygous p.W355R mutation at exon 4 of the 3 beta-hydroxysteroid dehydrogenase type II (HSD3beta2) gene in both siblings. PMID: 27476613
  4. the first HSD3B2 gene mutation in the Italian population and analyzed its effect in the context of the 3beta-HSD2 structure and function. PMID: 27082427
  5. The steroidogenic enzymes cytochrome P450 cholesterol side-chain cleavage enzyme (P450scc), cytochrome P450 17 alpha-hydroxylase (P450c17) and 3beta-hydroxysteroid dehydrogenase (3beta-HSD) showed immunoreactivity in 9/20 (45.0 %), 15/20 (75.0 %) and 13/20 (65.0 %), respectively, of ovarian-type stroma from pancreatic mucinous cystic neoplasm cases. PMID: 27060902
  6. Patients with HSD3B2 deficiency and 21-hydroxylase deficiency suffer similar morbid complications from under- and overtreatment, but HSD3B2 deficiency is associated with a distinctive pattern of sex steroid dysmetabolism. PMID: 26079780
  7. both area and ratio of 3betaHSD and CYB5A double positive cells, which could represent the hybrid cells of zona fasciculate and zona reticularis, are correlated with adrenal development and could influence age-related serum androstenedione levels. PMID: 24832628
  8. the CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels in metastases were significantly lower. PMID: 24244276
  9. The cause of adrenocortical insufficiency in the studied family appears to be two novel homozygous mutations in the 3beta-HSD gene. PMID: 23026940
  10. low ratio of cytochrome P450 family 17/3 beta-hydroxysteroid dehydrogenase type II with high expression of steroid 11-beta-monooxygenase seems to explain steroidogenic characteristics of aldosterone-producing adenomas PMID: 23257735
  11. HSD3B SNP and gene-gene interactions in genetic susceptibility to bladder cancer PMID: 23284679
  12. Interleukin-4 and prostaglandin E2 synergistically up-regulate 3beta-hydroxysteroid dehydrogenase type 2 in endometrioma stromal cells. PMID: 23450050
  13. snps in HSD3B2 was in men associated with a lower risk of paranoid ideation. PMID: 22356824
  14. Mitochondrial HSD3B2 activity requires reversible pH-dependent conformational change at the intermembrane space. PMID: 22262841
  15. Data suggest that HSD3B2 interacts/unfolds in presence of specific liposomes (unilamellar liposomes of DPPG/DPPC). This lipid-mediated unfolding completely supports model in which cavity forms between alpha-helix and beta-sheet to activate enzyme. PMID: 22106846
  16. 3beta-hydroxysteroid dehydrogenase type 2 PMID: 21930695
  17. Human adrenal cells that express both 3beta-hydroxysteroid dehydrogenase type 2 (HSD3B2) and cytochrome b5 (CYB5A) contribute to adrenal androstenedione production PMID: 21185375
  18. SNPs located within the HSD3B2 gene were not associated with essential hypertension. PMID: 20660004
  19. LRH-1 is highly expressed in corpus luteum, and it plays an essential role in the regulation of HSD3B2. PMID: 14671206
  20. Subtle molecular abnormalities in HSD3B2 gene may be observed in some patients with apparent idiopathic hypospadias. This finding is uncommon. PMID: 14764821
  21. Transcription enhancer factor-5 and the GATA-like protein act in a coordinate manner to determine the placental-specific expression of the human 3betaHSD I enzyme PMID: 15131259
  22. regulation of transcription by NGFIB PMID: 15208301
  23. HSD3B2 is upregulated by the nerve growth factor-induced clone B family of transcription factors. PMID: 15615861
  24. HSD3B2 promoter (hHSD3B2), which contains four consensus GATA elements, constitutes an important target for GATA factors. PMID: 15928316
  25. Differences in fibroblast-derived glucocorticoid production (via the enzyme 11beta-HSD1) between cells from distinct anatomical locations may play a key role in the predeliction of certain tissues to develop persistent inflammation. PMID: 16846535
  26. HSD3B2 (TG)n,(TA)n,(CA)n intron 3 length polymorphism is associated with both prostate cancer risk and aggressiveness. PMID: 17823934
  27. Lower 3beta-hydroxysteroid dehydrogenase type 2 but higher 17,20-lyase activity in NCI-H295R cells explaining the 'androgenic' steroid profile for these cells and resembling the zona reticularis of the human adrenal cortex. PMID: 18000308
  28. characterization of 3 novel homozygous mutations in HSD3B2 gene in patients with classic salt-losing 3beta-HSD deficiency; study concludes the C-terminal part of type II 3beta-HSD protein is essential for correct functioning & processing of the molecule PMID: 18252794
  29. In cortices attached to adrenocortical adenomas, HSD3B2 mRNA was expressed in zona glomerulosa and zona fasciculata, but only sporadically in zona reticularis. PMID: 18505908
  30. Structure/function of the inhibition of HSD3B2 by trilostane is reported. PMID: 18524572
  31. both SF1 and LRH1 can transcriptionally cooperate with the AP-1 family members c-JUN and c-FOS, known to be associated with enhanced proliferation of endometrial carcinoma cells, to further enhance activation of the STAR, HSD3B2, and CYP19A1 PII promoters PMID: 19022561
  32. In human adrenal cells, FXR increases transcription and expression of HSD3B2. PMID: 19059462
  33. NGFI-B family members induced promoter activity of 3-beta-hydroxysteroid-dehydrogenase type 2 (HSD3B2), 21-hydroxylase (CYP21A2), and aldosterone synthase (CYP11B2). PMID: 19158234

Show More

Hide All

Involvement in disease
Adrenal hyperplasia 2 (AH2)
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Protein Families
3-beta-HSD family
Tissue Specificity
Expressed in adrenal gland, testis and ovary.
Database Links

HGNC: 5218

OMIM: 201810

KEGG: hsa:3284

STRING: 9606.ENSP00000358424

UniGene: Hs.654399

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*