Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR), partial

In Stock
Code CSB-EP010565HU
Abbreviation Recombinant Human HMGCR protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
3 hydroxy 3 methylglutaryl CoA reductase; 3 hydroxy 3 methylglutaryl Coenzyme A reductase; 3 hydroxymethylglutaryl CoA reductase; 3-hydroxy-3-methylglutaryl CoA reductase (NADPH); 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 3H3M; HMDH_HUMAN; HMG CoA reductase; HMG CoAR; HMG-CoA reductase; Hmgcr; Hydroxymethylglutaryl CoA reductase; LDLCQ3; MGC103269; Red
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
588-887aa
Target Protein Sequence
MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this recombinant Human HMGCR protein is just like all recombinant proteins. The process involved transfecting E.coli cells with DNA vector containing the template of recombinant DNA. The E.coli cells containing the template were then cultured so that they could transcribe and translate the HMGCR protein. N-terminal 6xHis tag was used in the process. The purity is 90% determined by SDS-PAGE.

HMGCR is a gene providing instructions for making a protein called 3-hydroxy-3-methylglutaryl-coenzyme A reductase (also known as HMG-CoA reductase), which is the rate-controlling enzyme of the mevalonate pathway, the metabolic pathway that produces cholesterol and other isoprenoids. HMG-CoA reductase catalyzes the NADPH-dependent reduction of HMG-CoA to mevalonic acid, a necessary step in the biosynthesis of cholesterol. Currently, this enzyme is the target of the widely available cholesterol-lowering drugs, such as statins, which help treat dyslipidemia.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of (3S)-hydroxy-3-methylglutaryl-CoA (HMG-CoA) to mevalonic acid, the rate-limiting step in the synthesis of cholesterol and other isoprenoids, thus plays a critical role in cellular cholesterol homeostasis. HMGCR is the main target of statins, a class of cholesterol-lowering drugs.
Gene References into Functions
  1. High HMGR expression is associated with breast cancer metastasis. PMID: 29626418
  2. High HMGCR expression is associated with hypercholesterolemia. PMID: 29678744
  3. The presence of rs17244841 ve rs17238540 mutations in HMGCR causes a significant reduction in total cholesterol and LDL-c levels. PMID: 29096742
  4. A positive relationship emerged between HMG-CoAR, hormone receptors and TAZ/YAP, suggesting a connection between the mevalonate pathway, the hormonal milieu and Hippo in Male breast cancer. Moreover, HMG-CoAR expression may be a favorable prognostic indicator. PMID: 27713571
  5. HMGCR genetic variation is associated with Alzheimer's disease. PMID: 26950278
  6. our study demonstrates A allele of HMGCR rs3846662 acts as a protective factor for late-onset Alzheimer's disease in northern Han Chinese PMID: 27009838
  7. UBXD8 is necessary for sterol-stimulated dislocation of ubiquitylated HMGCR from the endoplasmic reticulum membrane en route to proteasomal degradation, a function dependent on its UBX domain. PMID: 28882874
  8. The docking studies indicate rutin as the best compound that can inhibit HMG-CoA reductase as it had strong binding affinity to the enzyme. PMID: 27216569
  9. Both HMGCR and SQLE promoters have two SREs that may act as a homing region to attract a single SREBP-2 homodimer. PMID: 28342963
  10. To estimate the association between changes in levels of LDL-C (and other lipoproteins) and the risk of cardiovascular events related to variants in the CETP gene, both alone and in combination with variants in the 3-hydroxy-3-methylglutaryl-CoA reductase (HMGCR) gene. PMID: 28846118
  11. Low LDL cholesterol levels due to PCSK9 and HMGCR variants had no causal effect on high risk of Alzheimer's disease, vascular dementia, any dementia, or Parkinson's disease; however, low LDL cholesterol levels may have a causal effect in reducing the risk of Alzheimer's disease. PMID: 28438747
  12. TGF-beta1 induces cholesterol synthesis by increasing HMG-CoA reductase mRNA expression in keratinocytes. PMID: 26932266
  13. Gene expression profile and the biological functions of HMGCR in gastric cancer were studied. It was found that the expression of HMGCR was increased in gastric cancer tissues. Over-expression of HMGCR promoted the growth and migration of gastric cancer cells, while knocking down the expression of HMGCR inhibited the growth, migration and tumorigenesis of gastric cancer cells. PMID: 27085483
  14. In this study, variants in PCSK9 had approximately the same effect as variants in HMGCR on the risk of cardiovascular events and diabetes per unit decrease in the LDL cholesterol level. The effects of these variants were independent and additive. PMID: 27959767
  15. Data show that simvastatin significantly inhibited cellular proliferation, induced cell cycle G1 arrest and apoptosis, and caused cellular stress via reduction in the enzymatic activity of 3-hydroxy-3-methyl-glutaryl-CoA reductase (HMGCR). PMID: 26503475
  16. no associations found between HMGCR rs3846662, HMRCR alternative splicing and Alzheimer's disease pathology pathology. PMID: 26541602
  17. results indicate that abnormal lipid metabolism may exist in spontaneous preterm delivery (SPTD) women and the premature fetus and the HMGCR gene may be a susceptible gene for SPTD PMID: 26301579
  18. Report the mechanism of polyphenol binding to and activity regulation of HMGR using molecular docking. PMID: 26357462
  19. the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2. PMID: 26302339
  20. Discovery new drug candidates for inhibition of human HMG-CoA reductase through structure-based virtual screening. PMID: 26170618
  21. Results show that HMGCR rs3846662 acts as a potent genetic modifier for Alzheimer's disease risk, age of onset and conversion from mild cognitively impairment PMID: 25023145
  22. study demonstrated the oncogenic roles of HMGCR in glioblastoma cells and HMGCR might be a promising therapeutic target. PMID: 26432005
  23. the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells. PMID: 25933205
  24. Data show that sterols stimulate binding of prenyltransferase UBIAD1 to HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol. PMID: 25742604
  25. Human carotid atherosclerotic lesion protein components decrease cholesterol biosynthesis rate in macrophages through 3-hydroxy-3-methylglutaryl-CoA reductase regulation. PMID: 25639207
  26. miR-21 regulates triglyceride and cholesterol metabolism in non-alcoholic fatty liver disease by targeting HMGCR PMID: 25605429
  27. The effect of lower LDL-C on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both is approximately the same per unit lower LDL-C and log-linearly proportional to the absolute exposure to lower LDL-C. PMID: 25770315
  28. promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD. PMID: 25084356
  29. Strong HMGCR expression is associated with high response to radiotherapy in ductal carcinoma-in situ. PMID: 24777857
  30. The results show that carriage of SNPs in the HMGCR gene were associated with bodyweight gain and increased risk of type 2 diabetes PMID: 25262344
  31. HMGCR is differentially expressed in colorectal cancer and that positive expression is associated with favourable tumour characteristics and a prolonged survival in unadjusted analysis. PMID: 24708688
  32. HMGCR is upregulated in hepatocellular carcinoma associated with paraneoplastic hypercholesterolemia. PMID: 23549978
  33. findings show that HNRNPA1 modulates the expression level of an alternatively spliced transcript of HMGCR by regulating splicing and altering RNA stability, resulting in reduced HMGCR enzyme activity and increased LDL-Cholesterol uptake PMID: 24001602
  34. Data indicate that RNAi-mediated knockdown of VCP/p97 blocks sterol-accelerated degradation but not ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reduc (HMG CoA reductase) in SV-589 cells. PMID: 24025715
  35. HMGCR-mediated changes in F-actin structure play an important role in the inter-cellular transmission of respiratory syncytial virus infection. PMID: 23994498
  36. Over-expression of HMGCR in esophageal squamous cell carcinoma (ESCC) cells promoted cell growth and migration. PMID: 24390662
  37. knockdown of MARCH6 also controls the level of 3-hydroxy-3-methyl-glutaryl coenzyme A reductase (HMGCR) in hepatocytes and model cell lines PMID: 24449766
  38. Increased cholesterol synthesis mediated by HMGCoA-R under inflammatory stress may be one of the mechanisms for intracellular lipid accumulation and statin resistance. PMID: 24233489
  39. Age and sex modify the contribution of the HMGCR-911 polymorphism to fasting serum total cholesterol, LDL-cholesterol levels and risk of coronary heart disease. PMID: 23933271
  40. These results suggest that dengue virus infection increases intracellular cholesterol levels at early times post infection by triggering the modulation of LDL particles uptake and the increase in the enzymatic activity of HMG-CoA reductase. PMID: 23642566
  41. A novel role for Aup1 in maintenance of intracellular cholesterol homeostasis via mediation of the endoplasmic reticulum associated degradation of HMG-CoA reductase. PMID: 23223569
  42. Statins up-regulate the expression of HMGCR, the major target of autoantibodies in statin-associated immune-mediated necrotizing myopathy. PMID: 21360500
  43. The association of HMGCR promoter region polymorphisms with cholesterol levels and coronary artery disease in patients from Western India are reported. PMID: 22858685
  44. This study was designed to understand the mode of interactions of HMGCR isoform 2 with statins Atorvastatin, Lovastatin, Fluvastatin, Simvastatin, Pravastatin, Rosuvastatin and Cerivastatin. PMID: 22177940
  45. The HMGCR rs3846662 GG genotype was quantitatively documented to be a significant determinant for higher LDL-C level in basal state and possibly in response to atorvastatin. PMID: 21427285
  46. Reductions in plasma insulin may have affected the expression of a key regulatory gene of cholesterol synthesis, HMG-CoA reductase and low-density lipoprotein receptor. PMID: 22024489
  47. HMG-CoA reductase activation and urinary pellet cholesterol elevations in acute kidney injury. PMID: 21799150
  48. HMG-CoA reductase regulation takes place at the levels of transcription, translation, post-translational modification and degradation. (Review) PMID: 21801748
  49. Linalool reduces the expression of 3-hydroxy-3-methylglutaryl CoA reductase via sterol regulatory element binding protein-2- and ubiquitin-dependent mechanisms. PMID: 21944868
  50. inhibition of protein geranylgeranylation markedly attenuated ubiquitylation and dislocation, implicating for the first time a geranylgeranylated protein(s) in the metabolically regulated ERAD of HMGR. PMID: 21778231

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Multi-pass membrane protein.
Protein Families
HMG-CoA reductase family
Tissue Specificity
[Isoform 1]: Ubiquitously expressed with the highest levels in the cerebellum, fetal brain, testis, skin and adrenal gland.; [Isoform 2]: Detected in the cerebellum, fetal brain, testis and adrenal gland.; [Isoform 3]: Low abundance except in skin, esopha
Database Links

HGNC: 5006

OMIM: 142910

KEGG: hsa:3156

STRING: 9606.ENSP00000287936

UniGene: Hs.628096

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*