Recombinant Human 40S ribosomal protein S27 (RPS27)

Discontinued
Code CSB-EP020419HU
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RPS27
Uniprot No.
Research Area
others
Alternative Names
2610206D02Rik; 3200001M24Rik; 40S ribosomal protein S27; C530005D02Rik; Metallopan stimulin 1; Metallopan-stimulin 1; Metallopanstimulin 1; Metallopanstimulin1; MPS 1; MPS-1; MPS1; pmn; Ribosomal protein S27; Ribosomal protein S27 metallopanstimulin 1; rps27; RS27_HUMAN; S27; snoRNA MBI 112
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-84aa
Target Protein Sequence
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the small ribosomal subunit. Required for proper rRNA processing and maturation of 18S rRNAs.
Gene References into Functions
  1. Chloride anion behaves as a signaling effector for CFTR in the modulation of RPS27 expression. PMID: 28941802
  2. reveal how Mps1 dynamically modifies kinetochores to correct improper attachments and ensure faithful chromosome segregation PMID: 28441529
  3. MPS1 is a new marker of Purkinje Cells. PMID: 26708598
  4. We identified frequent recurrent (i.e. hotspot) mutation in the 5' untranslated region of RPS27 in ~10% of melanoma samples PMID: 24913145
  5. The data on genome context analysis indicates that the presence of MPS-1 in the blood is an indicator of oncogenesis PMID: 22798506
  6. This work is consistent with a critical role of RPMPS-1/S27 in the life cycle of various viruses and shows that disruption of viral ZFPs is potentially important to control and prevent deathly viral diseases PMID: 21518817
  7. study reveals a multilevel interplay between RPS27L/S27 and p53-MDM2 axis, with RPS27L functioning as a p53 target, a MDM2 substrate and a p53 regulator PMID: 21170087
  8. When MPS-1 is overexpressed, it has an extraribosomal function as a strong inhibitor of HNSCC tumor cell growth, which may be exerted by reduced paxillin gene expression. PMID: 19642098
  9. MPS-1 was overexpressed in 86% of the gastric cancer tissues and all gastric cancer cells. MPS-1 expression was significantly increased and corresponded with the tumor-node-metastasis clinical stage, and was significantly higher in the late stage. PMID: 16914586

Show More

Hide All

Involvement in disease
Diamond-Blackfan anemia 17 (DBA17)
Protein Families
Eukaryotic ribosomal protein eS27 family
Tissue Specificity
Expressed in a wide variety of actively proliferating cells and tumor tissues.
Database Links

HGNC: 10416

OMIM: 603702

KEGG: hsa:6232

STRING: 9606.ENSP00000357555

UniGene: Hs.546291

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*