Recombinant Human 40S ribosomal protein S3(RPS3)

Code CSB-EP020443HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names RPS3
Uniprot No. P23396
Research Area Others
Alternative Names 40S ribosomal protein S3; fb13d09; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC56088; MGC87870; OTTHUMP00000229804; OTTHUMP00000229805; OTTHUMP00000229874; OTTHUMP00000229877; OTTHUMP00000229878; OTTHUMP00000229879; OTTHUMP00000229880; OTTHUMP00000229882; OTTHUMP00000229883; OTTHUMP00000229886; Ribosomal protein S3; rps3; RS3_HUMAN; S3; wu:fb13d09; zgc:56088
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-243aa
Target Protein Sequence AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 42.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Involved in translation as a component of the 40S small ribosomal subunit
Gene References into Functions
  1. Results found that BfrB subverts the host innate immune system by binding the NF-kappaB subunit RPS3 and promotes the survival of mycobacteria in macrophages by inhibiting cytokine production in host cells. PMID: 29018126
  2. These results reveal that RPS3 upregulates XIAP independently of the NF-kappaB pathway in human breast cancer cells PMID: 29048653
  3. Asn 165 residue of rpS3 is a critical site for N-linked glycosylation and passage through the ER-Golgi secretion pathway. PMID: 27384988
  4. findings suggest that uS3 residing in the 40S ribosome might perform extra-ribosomal functions related to control of DNA quality PMID: 28334742
  5. Short 5'UTR mRNAs are enriched with TISU (translation initiator of short 5'UTR), a 12-nucleotide element directing efficient scanning-independent translation. This study demonstrate that TISU is particularly dependent on eukaryotic initiation factor 1A (eIF1A) which interacts with both RPS3 and RPS10e. PMID: 28584194
  6. Data show that ribosomal protein S3 (RPS3) knockdown decreased mitochondrial calcium uptake 1 protein (MICU1) expression. PMID: 26336993
  7. Increased RPS3 expression is associated with osteosarcoma invasion. PMID: 25449781
  8. RPS3, a component of basic translation machinery operates at initiation and most probably elongation of protein synthesis, is also implicated in various events of the cell life as an extraribosomal player. [Review] PMID: 24239944
  9. These findings suggest that the secreted rpS3 protein is an indicator of malignant tumors. PMID: 24211576
  10. rpS3 accumulates in the mitochondria to repair damaged DNA due to the decreased interaction between rpS3 and HSP90 in the cytosol. PMID: 23911537
  11. rpS3 acts as a microtubule associated protein and regulates spindle dynamics during mitosis. PMID: 23131551
  12. A novel radioresistance mechanism through functional orchestration of rpS3, TRAF2, and NF-kappaB in non-small cell lung cancer cells, is reported. PMID: 23188828
  13. rpS3 is recruited to the DISC and plays a critical role in both genotoxic stress and cytokine induced apoptosis. PMID: 22510408
  14. The phosphorylation of rpS3 by Cdk1 occurs at Thr221 during G2/M phase. PMID: 21871177
  15. rpS3 is covalently modified by SUMO-1 and this post-translational modification regulates rpS3 function by increasing rpS3 protein stability. PMID: 21968017
  16. Data show that the IKKbeta-dependent modification of a specific amino acid in RPS3 promoted specific NF-kappaB functions that underlie the molecular pathogenetic mechanisms of E. coli O157:H7. PMID: 21399639
  17. PEP-1-rpS3 inhibits inflammatory response cytokines and enzymes by blocking NF-kappaB and MAP kinase, prompting the suggestion that PEP-1-rpS3 can be used as a therapeutic agent against skin inflammation. PMID: 20709134
  18. when Flag-tagged rpS3 was transiently transfected into 293T cells, the level of endogenous rpS3 gradually decreased regardless of transcription PMID: 20217897
  19. DNA pull-down assays using a 7,8-dihydro-8-oxoguanine duplex oligonucleotide as a substrate found that RPS3 acted as a scaffold for the additional binding of MDM2 and p53. PMID: 19656744
  20. Electron paramagnetic resonance study reveals a putative iron-sulfur cluster in human rpS3 protein. PMID: 11911468
  21. RPS3 is involved in apoptosis. PMID: 14988002
  22. Using surface plasmon resonance technology, the authors show that ribosomal protein S3 positively interacts with the human base excision repair enzymes N-glycosylase/apurinic-apyrimidinic lyase OGG1 and APE/Ref-1. PMID: 15518571
  23. The S3-K132A mutant retained the ability to cleave abasic DNA, but its capacity to bind 8-oxoG was abrogated completely. PMID: 16737853
  24. PEP-1-rpS3 fusion protein can be used in protein therapy for various disorders related to UV, including skin aging and cancer PMID: 17140567
  25. S3 is a key protein at the mRNA binding site neighboring mRNA downstream of the codon at the decoding site in the human ribosome. PMID: 17179743
  26. hRpS3 may be involved in the uracil-excision pathway, probably by participating in the DNA repair mechanism to remove uracil generated by the deamination of cytosine in DNA, and by preventing C/G-->T/A transition mutations. PMID: 18973764
  27. Protein S3 fragments neighboring mRNA during elongation and translation termination on the human ribosome PMID: 19088750
  28. these results clearly show that arginine methylation of rpS3 plays a critical role in its import into the nucleolus, as well as in small subunit assembly of the ribosome. PMID: 19460357

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus, Nucleus, nucleolus, Mitochondrion inner membrane, Peripheral membrane protein, Cytoplasm, cytoskeleton, spindle
Protein Families Universal ribosomal protein uS3 family
Database Links

HGNC: 10420

OMIM: 600454

KEGG: hsa:6188

STRING: 9606.ENSP00000433821

UniGene: Hs.546286

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1