Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
40S ribosomal protein S3; fb13d09; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC56088; MGC87870; OTTHUMP00000229804; OTTHUMP00000229805; OTTHUMP00000229874; OTTHUMP00000229877; OTTHUMP00000229878; OTTHUMP00000229879; OTTHUMP00000229880; OTTHUMP00000229882; OTTHUMP00000229883; OTTHUMP00000229886; Ribosomal protein S3; rps3; RS3_HUMAN; S3; wu:fb13d09; zgc:56088
Species
Homo sapiens (Human)
Expression Region
2-243aa
Target Protein Sequence
AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 2-243 constitute the expression domain of recombinant Human RPS3. The expected molecular weight for the RPS3 protein is calculated to be 42.6 kDa. This RPS3 recombinant protein is manufactured in e.coli. The RPS3 coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant RPS3 protein in following stages of expression and purification.
The human 40S ribosomal protein S3 (RPS3) is a vital component of the small ribosomal subunit, playing a crucial role in protein synthesis. RPS3 is involved in multiple cellular processes beyond its ribosomal function, serving as a multifunctional protein with roles in transcriptional regulation, DNA repair, and apoptosis. In transcriptional regulation, RPS3 interacts with transcription factors and regulates the expression of certain genes. Additionally, RPS3 has been implicated in DNA repair mechanisms, participating in the maintenance of genomic stability. Moreover, it plays a role in apoptosis, contributing to the regulation of programmed cell death. The multifaceted functions of RPS3 highlight its significance in cellular homeostasis and underscore its potential implications in various physiological and pathological conditions.
