Recombinant Human 5'-AMP-activated protein kinase subunit beta-1 (PRKAB1)

Code CSB-YP889918HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP889918HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP889918HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP889918HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP889918HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
5'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPKb; PRKAB1 AMPK
Species
Homo sapiens (Human)
Expression Region
2-270
Target Protein Sequence
GNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
Gene References into Functions
  1. we studied the role of the beta 1 subunit in erythrocytes and observed microcytic anemia with compensatory extramedullary hematopoiesis together with splenomegaly and increased osmotic resistance. PMID: 27666489
  2. Salicylate activates the AMP-activated protein kinase (AMPK) by binding at the A-769662 drug binding site on the AMPK beta1-subunit PMID: 25940306
  3. findings suggest that the reduced expression of AMPK-beta1 confers lower AMPK activity, which enhances the oncogenic capacity of advanced-stage ovarian cancer. PMID: 24602453
  4. The effects of ethanol on AMPK and PP2A may result in activation of ChREBP, providing another potential mechanism for ethanol-induced hepatic steatosis. PMID: 23266705
  5. Data indicate that a diet high in iron improves glucose tolerance by activating AMPK through mechanisms that include deacetylation. PMID: 23515442
  6. LKB1 controls IRS1-dependent adipogenesis via AMPK in white adipose tissue. PMID: 23396401
  7. Changes in translational control of mitochondrial proteins are signaled by the activation of AMPK and general control non-derepressible kinase 2 (GCN2), leading also to the activation of autophagy. PMID: 22435535
  8. Phosphorylation levels of AMPK and glycolysis were up-regulated to confer an advantage of survival for MERRF skin fibroblasts. PMID: 22001850
  9. Adipose tissues of markedly obese insulin resistant individuals uniformly show decreased AMPK activity and increased oxidative stress compared with insulin sensitive patients. PMID: 22323564
  10. Adiponectin could attenuate renal dysfunction associated with mesangial cells disorders through AMPK-mTOR signal pathway. PMID: 22105511
  11. 1q21.1 copy number variant (CNV) results in gene function changes, specifically in the deletion containing lymphobalst cell lines, where AMPK was attenuated. PMID: 21824431
  12. AMPK, Akt and mTOR pathways have roles in resveratrol-enhanced prostate cancer cell response to ionizing radiation PMID: 22029423
  13. cisplatin-triggered activation of AMPK and subsequent suppression of mTOR activity can induce an autophagic response that protects tumour cells from cisplatin-mediated apoptotic death PMID: 20196784
  14. LKB1-AMPK negatively regulated mTOR function in tumor. PMID: 21859551
  15. NT5C1A suppression promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle PMID: 21873433
  16. Inactivation of fumarate hydratase drives a metabolic shift to aerobic glycolysis in FH-de fi cient kidney tumors resulting in decreased levels of AMP-activated kinase. PMID: 21907923
  17. Phosphorylation of AMPK by Ulk1 represents a negative feedback circuit. PMID: 21460634
  18. Androgen deprivation and hypoxia augmented AMPK activation and triggered autophagy in androgen-dependent prostate cancer cells. PMID: 21554950
  19. Glucose deprivation resulted in activation of AMPK and inhibition of Akt phosphorylation PMID: 21570709
  20. Glucose restriction or treatment of human diploid fibroblasts (HDFs) with the activators of the AMPK/p53 pathway induced the expression of IFI16 protein. PMID: 21573174
  21. results of this study show that AMPK induces MUC5B expression through the p38 MAPK signaling pathway in airway epithelial cells. PMID: 21619869
  22. The connections between AMPK and FoxO3A, are reviewed. PMID: 20190568
  23. The aim of this study was to investigate the effects of adiponectin on StAR protein expression, steroidogenic genes, and cortisol production and to dissect the signalling cascades involved in the activation of StAR expression. PMID: 21334384
  24. High AMPK expression is associated with ovarian carcinoma. PMID: 21271224
  25. AMPK is abnormally activated in tangle- and pre-tangle-bearing neurons in Alzheimer's disease and other tauopathies. PMID: 20957377
  26. Endoplasmic reticulum stress triggers suppression of AMPK while increasing C/EBPbeta and pCREB expression which activates PEPCK gene transcription. PMID: 20797423
  27. There is a mutual suppressive interaction between AMPK and Akt. PMID: 21042744
  28. AMPK-mediated PLD1 activation is required for (14)C-glucose uptake through ERK stimulation PMID: 20231899
  29. The LKB1/AMPK/TSC tumor suppressor axis is functional in acute myeloid leukemia. PMID: 20668229
  30. These results suggest that the modification introduced by the laforin-malin complex could affect the subcellular distribution of AMPK beta subunits. PMID: 20534808
  31. Data suggest that AMPK is required for the serum starvation-related increase in insulin-stimulated glucose transport, with ATM as a possible downstream effector. PMID: 20810907
  32. The nuclear translocation of GAPDH might be regulated by the PI3K signaling pathway acting mainly as a nuclear export signal and the AMPK signaling pathway acting as a nuclear import signal. PMID: 20177150
  33. These observations support a role for AMPK in the regulation of Na+-coupled glucose transport. PMID: 20334581
  34. AMP-activated protein kinase inhibition mediates hepatitis C virus genome replication and lipid accumulation PMID: 20534540
  35. Data demonstrate that autophagy depends on the early activation of the AMP-activated protein kinase (AMPK)/mTOR-mediated pathway. PMID: 20083895
  36. Data showed that HDL-induced activation of AMPK is dependent on both sphingosine 1-phosphate receptors and scavenger receptor class B type I. PMID: 20018878
  37. Data suggest that upregulation of adipose triglyceride lipase and suppression of hormone-sensitive lipase and AMP kinase signaling mediate high-fat diet-induced alterations in lipolysis and lipid utilization in adipocytes. PMID: 20107043
  38. findings suggest that CCL2 hyperactivates mTORC1 through simultaneous regulation of both AMPK and Akt pathways and reveals a new network that promotes prostate cancer: CCL2-AMPK-mTORC1-survivin. PMID: 20019839
  39. Chlorophyll a up-regulated the AMPK and p-AMPK levels, and down-regulated the expression of PPAR-gamma. PMID: 19963029
  40. we will examine the evidence that AMP-activated protein kinase and SIRT1 both regulate each other and share many common target molecules--REVIEW PMID: 20103737
  41. These results indicate that AMPK activators facilitate the activation by TRAIL of an apoptotic cell death program through a mechanism independent of AMPK and dependent on the down-regulation of cFLIP levels. PMID: 19896469
  42. It is necessary to clarify the tissue-specific and stress-specific activation mechanism of AMPK--REVIEW PMID: 19911004
  43. AMPK is a novel and biologically significant participant with a tumor suppressive activity in the mitotic/cytokinetic phase of the cell cycle. PMID: 19844168
  44. Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex. There is a synergistic effects of Ca2+ and AMP. PMID: 19958286
  45. Data show that AMPK activation suppressed Ox-LDL-induced macrophage proliferation by suppressing GM-CSF expression and inducing cell cycle arrest. PMID: 19843515
  46. AMP-activated protein kinase has a role in gene expression in single islet beta-cells [review] PMID: 15289653
  47. Dipyridamole, an adenosine transporter inhibitor, and 5'-amino-5'-deoxyadenosine, an adenosine kinase inhibitor, blocked the effect of AICAR on the down-regulation of the insulin receptor protein, mRNA, and promoter activity. PMID: 15694368
  48. Reduced activation of AMPK by globular adiponectin in obese and obese type 2 diabetic subjects is not caused by reduced adiponectin receptor expression. PMID: 15769985
  49. it is likely that the AMPK-GDE association is a novel mechanism regulating AMPK activity and the resultant fatty acid oxidation and glucose uptake PMID: 15886229
  50. These results suggested that the combination of 5-FU and genistein exert a novel chemotherapeutic effect in colon cancers, and AMPK may be a regulatory molecule of COX-2 expression, further implying its involvement in cytotoxicity caused by genistein. PMID: 15896711

Show More

Hide All

Protein Families
5'-AMP-activated protein kinase beta subunit family
Database Links

HGNC: 9378

OMIM: 602740

KEGG: hsa:5564

STRING: 9606.ENSP00000229328

UniGene: Hs.741184

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1