Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

HTR1D

Uniprot No.

P28221

Research Area

Others

Alternative Names

HTR1D; HTR1DA; HTRL; 5-hydroxytryptamine receptor 1D; 5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-38aa

Target Protein Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

33.1 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the process of expressing the recombinant Human HTR1D protein, mammalian cells are transfected with a DNA expression vector that carries the gene encoding the desired protein (1-38aa). The cells are then cultured to induce the expression of the intended protein. The protein features a C-terminal hFc tag fusion. The recombinant Human HTR1D protein is collected and purified from the cell lysate through affinity purification, with its purity surpassing 90%, as assessed by SDS-PAGE.

Target Background

Function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

Gene References into Functions

Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway. PMID: 26214021
results suggest that 5-HT signaling participates in regulation of overall islet hormone secretion in non- diabetic individuals and over-expression of HTR1D and HTR2A may either contribute to islet dysfunction in T2D PMID: 26206285
study identified the presence of genetic association at chromosome 1p36 with migraine with aura (P=0.045, Bonferroni corrected): the locus encoding the 5HT(1D) receptor gene PMID: 22107845
This study reveals sex-specific alterations in gene expression of the pre-synaptic 5-HT1D autoreceptors and 5-HT-related transcription factors, NUDR and REST, in dorsal raphe neurons of women with major depression disorder. PMID: 19878438
Gene may be linked to etiology of anorexia nervosa. PMID: 12740597
Polymorphisms in the serotonin 5-HT1D receptor gene are preferentially transmitted in attention-deficit hyperactivity disorder in Chinese Han subjects. PMID: 17099886
The density of 5HT(1D)R was significantly more in tissues known to produce migraine-like pain. 5HT(1D)R-like immunoreactivity was restricted to neuronal fibres, colocalizing with calcitonin gene-related peptide & tyrosine hydroxylase positive fibres. PMID: 18557979
Cell adhesion modulates 5-HT(1D) and P2Y receptor signal trafficking differentially in LTK-8 cells. PMID: 18582865

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Detected in brain neocortex and caudate nucleus (at protein level).

Database Links

HGNC: 5289

OMIM: 182133

KEGG: hsa:3352

STRING: 9606.ENSP00000313661

UniGene: Hs.121482

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-MP010883HU2
Abbreviation	Recombinant Human HTR1D protein, partial
MSDS	MSDS Datasheet
Size	$660
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage