Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase (NUDT1)

Code CSB-YP016154HUa0
Abbreviation Recombinant Human NUDT1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
NUDT1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
2-hydroxy-dATP diphosphatase; 7 8 dihydro 8 oxoguanine triphosphatase; 7; 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase; 8 oxo 7 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; 8-dihydro-8-oxoguanine triphosphatase; 8-oxo-dGTPase; 8ODP_HUMAN; MTH 1; MTH1; MutT human homolog 1; Nucleoside diphosphate linked moiety X motif 1; Nucleoside diphosphate linked moiety X type motif 1; Nucleoside diphosphate-linked moiety X motif 1; Nudix (nucleoside diphosphate linked moiety X) type motif 1; Nudix hydrolase 1; Nudix motif 1; Nudix type motif 1; NUDT 1; Nudt1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
19-197aa
Target Protein Sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Has also a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress.
Gene References into Functions
  1. overall our cell viability data indicates that targeting MTH1 will likely not be an across-the-board effective non-small cell lung cancer therapeutic strategy; rather it induces non-cytotoxic DNA damage that could promote cancer heterogeneity and evolution. PMID: 29661172
  2. MTH1 is required for maintaining migration and invasion potential of human thyroid cancer cells. PMID: 30055508
  3. PRDX1 and MTH1 cooperate to prevent accumulation of oxidized guanine in the genome PMID: 29773556
  4. Results provide evidence that MTH1 is not essential for cancer cell survival. PMID: 27210421
  5. CDT1, MCM7, and NUDT1 were shown to be up-regulated in hepatocellular carcinoma tissues and provide a more accurate diagnosis than alpha-fetal protein alone. PMID: 29442275
  6. Our results reveal a novel antitumor mechanism of (S)-crizotinib in NSCLC which involves activation of ROS-dependent ER stress apoptotic pathway and is independent of MTH1 inhibition PMID: 28882182
  7. this study showed that MTH1 protein expression was closely related to factors associated with a high malignant potential and poor patient survival PMID: 28577950
  8. method for predicting individual residue contributions to enzyme specificity and binding-site energies, and its application to MTH1. PMID: 27714533
  9. Data indicate the specificity of the enzyme 8-oxo-dGTPase MTH1 toward the substrate 8-oxo-dGTP. PMID: 27350386
  10. We demonstrate that in order to kill cancer cells MTH1 inhibitors must also introduce oxidized nucleotides into DNA. Furthermore, we describe TH1579 as a best-in-class MTH1 inhibitor, which we expect to be useful in order to further validate the MTH1 inhibitor concept. PMID: 27827301
  11. Data indicate a positive correlation of Skp2 and MTH1 expression in melanoma cell lines and patient specimens. PMID: 28947420
  12. Results show that MTH1 is overexpressed in esophageal squamous cell carcinoma, and suggestive of disease progression. PMID: 27917618
  13. MTH1 together with MYH plays an important role in protection against mutations induced by modified dNTPs during chronic oxidative stress. PMID: 28340109
  14. Reduced MUTYH, MTH1, and OGG1 expression and TP53 mutations occur in diffuse-type adenocarcinoma of gastric cardia. PMID: 26980051
  15. Analyses of bond lengths with high-resolution X-ray data and the relationship between the structure and enzymatic activity revealed that hMTH1 recognizes the different oxidized nucleotides via an exchange of the protonation state at two neighboring aspartate residues (Asp-119 and Asp-120) in its substrate binding pocket PMID: 28035004
  16. MTH1 inhibition may offer a general approach to treat cancers characterized by deregulated hypoxia signaling or redox imbalance PMID: 26862114
  17. MTH-1 expression in colorectal cancer cells was upregulated via HIF-1alpha in response to hypoxic stress, emphasizing the crucial role of HIF-1alpha-induced MTH-1 in tumor growth. PMID: 26730155
  18. activity of MTH1 in different breast cancer cell lines has been detected, implying the potential application of this assay method for biomedical research and clinical diagnose in the future PMID: 26755138
  19. a novel approach involving liquid chromatography-isotope-dilution tandem mass spectrometry to positively identify and accurately quantify MTH1 in human tissues, is reported. PMID: 26202347
  20. MTH1 is the most prominent sanitizer of the cellular dNTP pool known to date. PMID: 26238318
  21. MTH1 expression is required for effective transformation of epithelial cells by oncogenic HRAS. PMID: 25893378
  22. Results show that MTH1 plays no role in protecting the cells against ultraviolet radiation-induced cytogenetic damage. PMID: 26520386
  23. Results suggest that the hMTH1-mediated maintenance of mtDNA stability protects cells from the susceptibility to oxidant injury associated with polyQ-expanded Htt, defends against 3-nitropropionic acid-induced neurodegeneration PMID: 22974734
  24. results indicate MTH1 is a novel and critical component of oncogenic KRAS-associated malignancy and its inhibition is likely to yield significant tumor-suppressive outcomes in KRAS-driven tumors. PMID: 25023700
  25. The ectopic expression of hMTH1 in the chloroplasts and mitochondria of Arabidopsis enhanced oxidative stress tolerance by activating the poly(ADP-ribosyl)ation (PAR)reaction and suppressing programmed cell death. PMID: 24928220
  26. Data suggest that hOGG1 could compensate for hMTH1 during oxidative DNA damage caused by H2O2, whereas hMTH1 could not compensate sufficiently for hOGG1 during the process. PMID: 25127756
  27. cancer cells require MTH1 activity to avoid incorporation of oxidized dNTPs, resulting in DNA damage and cell death; validation of MTH1 as an anticancer target in vivo PMID: 24695224
  28. MTH1 protects cells from mutagenesis induced by ultraviolet ray A and B, but not ultraviolet ray C.hMTH1 prevents induction of transition-type mutations at AT and GC post ultraviolet ray A irradiation. PMID: 24144844
  29. X-ray crystallographic analysis of MTH1 protein structure PMID: 23295485
  30. The risk of type 2 diabetes in the Chinese population is increased from the combined effects of AluYb8MUTYH with either hMTH1 c.247G>A or variants in the 5\'-UTR of the hOGG1. PMID: 23396182
  31. The study provides insight into the influence of MTH1 levels on the epithelial-mesenchymal transition phenotype and Akt activation in RAS-transformed HMLE breast epithelial cells. PMID: 22790201
  32. MutT homolog-1 attenuates oxidative DNA damage and delays photoreceptor cell death in inherited retinal degeneration. PMID: 22841817
  33. These results suggest that MTH1 deficiency might be a causative factor for aging and age-related disorders. PMID: 21538080
  34. results indicate that the nucleotide pool is a significant target for UVA-induced mutations and implicates that hMTH1 plays an important role in protecting cells from UVA-induced oxidative stress PMID: 21784087
  35. the structures of human MTH1 (1.9A) and its complex with the product 8-oxo-dGMP PMID: 21787772
  36. Manipulation of miR-145 expression modulates epidermal growth factor receptor (EGFR) and NUDT1 mRNA expressions. PMID: 21289483
  37. The expression levels of hMTH1 mRNA are highly correlated with hepatic levels of 8-oxo-dG and tail moment, suggesting that hMTH1 gene expression represents a molecular marker of oxidative DNA damage. PMID: 21421019
  38. Two rare variants (OGG1 c.137G>A; MUTYH c.1187G>A) and one common polymorphism (NUDT1 c.426C>T) were associated with colorectal cancer risk. PMID: 21355073
  39. human MTH1, MTH2, and NUDT5 proteins act as a defense against the mutagenesis induced by oxidized dGTP. PMID: 20144704
  40. Trp-117 is essential for MTH1 to recognize both 8-oxo-dGTP and 2-hydroxy-dATP, whereas Asp-119 is only essential for recognizing 2-hydroxy-dATP, thus suggesting that origins of the substrate-binding pockets for MTH1 and MutT are different PMID: 11756418
  41. 8-Chloro-dGTP, a hypochlorous acid-modified nucleotide, is hydrolyzed by hMTH1, the human MutT homolog. PMID: 11852070
  42. Role of tryptophan residues in the recognition of mutagenic oxidized nucleotides by human antimutator MTH1 protein PMID: 12051941
  43. These results suggested that increased expression of hMTH in peripheral lymphocytes may be a risk factor for prostate cancer and support our priori hypothesis. PMID: 12619034
  44. cleaves 8-oxo-dGTP to 8-oxo-GMP, an unusable form for DNA synthesis PMID: 12717453
  45. Elevated levels of hMTH1 protein is asociated with non-small-cell lung carcinomas PMID: 12757855
  46. MTH1 protects cells from H2O2-induced cell dysfunction and death by hydrolyzing oxidized purine nucleotides including 8-oxo-dGTP and 2-OH-dATP. PMID: 12857738
  47. dGDP and dADP, at physiological concentrations not exceeding 5 microM and GDP at mean concentration of 30 microM, taken together, can decrease the cellular hMTH1 enzymatic activity vs. 8-oxo-dGTP PMID: 12957652
  48. These results clarify the effects of the anti/syn conformation and the functional groups on the 2 and 6 positions of the purine ring on the recognition by the human MTH1 protein. PMID: 15095864
  49. study presents the solution structure of Nudix family hydrolase MTH1 solved by multidimensional heteronuclear NMR spectroscopy PMID: 15133035
  50. the Met allele at codon 83 of MTH1 gene might be involved in the development of type 1 diabetes mellitus in the Japanese female population. PMID: 15516784

Show More

Hide All

Subcellular Location
[Isoform p18]: Cytoplasm, cytosol. Mitochondrion matrix. Nucleus.; [Isoform p26]: Mitochondrion matrix.
Protein Families
Nudix hydrolase family
Tissue Specificity
Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.
Database Links

HGNC: 8048

OMIM: 600312

KEGG: hsa:4521

STRING: 9606.ENSP00000339503

UniGene: Hs.534331

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*