Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
2-hydroxy-dATP diphosphatase; 7 8 dihydro 8 oxoguanine triphosphatase; 7; 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase; 8 oxo 7 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; 8-dihydro-8-oxoguanine triphosphatase; 8-oxo-dGTPase; 8ODP_HUMAN; MTH 1; MTH1; MutT human homolog 1; Nucleoside diphosphate linked moiety X motif 1; Nucleoside diphosphate linked moiety X type motif 1; Nucleoside diphosphate-linked moiety X motif 1; Nudix (nucleoside diphosphate linked moiety X) type motif 1; Nudix hydrolase 1; Nudix motif 1; Nudix type motif 1; NUDT 1; Nudt1
Species
Homo sapiens (Human)
Expression Region
19-197aa
Target Protein Sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human NUDT1 was expressed with the amino acid range of 19-197. The expected molecular weight for the NUDT1 protein is calculated to be 22.8 kDa. The NUDT1 protein was expressed in baculovirus. The N-terminal 10xHis tag was fused into the coding gene segment of NUDT1, making it easier to detect and purify the NUDT1 recombinant protein in the later stages of expression and purification.
The current primary research area for NUDT1 (Oxidized purine nucleoside triphosphate hydrolase) involves the regulation of cellular nucleotide metabolism. Within cells, NUDT1 participates in maintaining nucleotide balance and genomic stability by hydrolyzing oxidized purine nucleoside triphosphates. Its role in DNA repair and antioxidant defense is of particular interest, especially its potential impact on the occurrence and development of diseases such as cancer. Researchers also focus on the association between NUDT1 and physiological processes like inflammation and metabolic regulation, providing a research foundation for exploring new therapeutic strategies.