Code | CSB-EP001996HU |
Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | ARF6 |
Uniprot No. | P62330 |
Research Area | Developmental Biology |
Alternative Names | ADP ribosylation factor 6 ; ADP ribosylation factor protein 6; ADP-ribosylation factor 6; ARF6; ARF6_HUMAN; DKFZp564M0264; Small GTP binding protein ; Small GTPase |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-175aa |
Target Protein Sequence | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 36.1kDa |
Protein Length | Full Length |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junction proteins such as CDH1. Required for NTRK1 sorting to the recycling pathway from early endosomes.; (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
|
Gene References into Functions |
|
Subcellular Location | Cytoplasm, cytosol. Cell membrane; Lipid-anchor. Endosome membrane; Lipid-anchor. Recycling endosome membrane; Lipid-anchor. Cell projection, filopodium membrane; Lipid-anchor. Cell projection, ruffle. Cleavage furrow. Midbody, Midbody ring. Early endosome membrane; Lipid-anchor. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor. |
Protein Families | Small GTPase superfamily, Arf family |
Tissue Specificity | Ubiquitous, with higher levels in heart, substantia nigra, and kidney. |
Database Links |
HGNC: 659 OMIM: 600464 KEGG: hsa:382 STRING: 9606.ENSP00000298316 UniGene: Hs.525330 |