Recombinant Human Actin-related protein 3 (ACTR3)

In Stock
Code CSB-EP001249HU
Abbreviation Recombinant Human ACTR3 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ACTR3
Uniprot No.
Research Area
Immunology
Alternative Names
Actin-like protein 3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-418aa
Target Protein Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament. In podocytes, required for the formation of lamellipodia downstream of AVIL and PLCE1 regulation. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs). Plays a role in ciliogenesis.
Gene References into Functions
  1. we conclude that ARP3 may be a potential prognostic indicator and therapeutic target for hepatocellular carcinoma PMID: 30049513
  2. RARalpha regulates Arp2/3-mediated actin cytoskeletal dynamics through a non-genomic signaling pathway PMID: 26848712
  3. evidence of a direct protein-protein interaction between PKD2 and Arp2/3 PMID: 27559607
  4. miR-24-1*/let-7a*-ARP2/3 complex-RAC isoforms pathway may represent a novel pathogenic mechanism for Hirschsprung disease. PMID: 26991540
  5. Authors found that ARP3 and profilin1 were 2 binding partners of LMO2, primarily in cytoplasm. LMO2. LMO2 mediated the assembly of a complex including ARP3, profilin1, and actin monomer, increased actin monomer binding to profilin1, and promoted lamellipodia/filopodia formation in basal-type breast cancer cells. PMID: 28170369
  6. Arp2 and Arp3 expression was increased under atherosclerotic conditions both in ApoE-/- mice and in oxidized low-density lipoproteins stimulated human coronary artery endothelial cells (HCAECs). PMID: 27181356
  7. These findings indicate that inhibition of the Rac1WAVE2Arp2/3 signaling pathway may promote radiosensitivity, which may partially result from the downregulation of CFL1 in U251 human glioma cells. PMID: 27052944
  8. Kv3.3 regulates Arp2/3-dependent cortical actin nucleation mediated by Hax-1; resulting cortical actin structures interact with the channel's gating machinery to slow its inactivation rate during sustained membrane depolarizations; a mutation that leads to late-onset spinocerebellar ataxia type 13. PMID: 26997484
  9. demonstrate that the Arp2/3 complex in higher eukaryotes is actually a family of complexes with different properties PMID: 26655834
  10. Platelet actin nodule formation is dependent on WASp and the ARP2/3 complex. PMID: 26028144
  11. Suggest alpha5beta1/Arp2/Arp3/FHOD3 pathway reprograms the actin cytoskeleton to promote invasive migration and local invasion in vivo. PMID: 26370503
  12. The loss of the Arp2/3 complex acts as a stress that initiates cell cycle arrest by triggering p16INK4a/p14Arf transcription. PMID: 25264243
  13. study unveils an ARP2/3:VCA-independent function of nuclear-WASp in TH1 gene activation that is uncoupled from its cytoplasmic role in actin polymerization. PMID: 24872192
  14. Cortactin has a role as a scaffold for Arp2/3 and WAVE2 at the epithelial zonula adherens PMID: 24469447
  15. The Arp2/Arp3 complex has a role in osmotic signaling. PMID: 24344184
  16. Study suggested that positive CFL1 and Arp3 expression are closely related to tumor progression, metastasis, and poor prognosis of gallbladder cancer. PMID: 23320827
  17. We demonstrate that WAVE2-Arp2/3 is a major nucleator of actin assembly at the zonula adherens and likely acts in response to junctional Rac signaling PMID: 23051739
  18. Anthrax edema toxin induced transendothelial cell tunnels are resealed by MIM via Arp2/3-driven actin polymerization. PMID: 22100162
  19. the centrosome transiently recruits Arp2/3 to perform processes such as centrosome separation prior to mitotic entry. PMID: 21108927
  20. The results identify Arp2/3 complex as a key factor in the generation of the dynamic actin cluster during mitosis. PMID: 20974812
  21. key residues at this interface were crucial for actin nucleation and Y-branching, high-affinity F-actin binding, and Y-branch stability, demonstrating that the affinity of Arp2/3 complex for F actin independently modulates branch formation and stability. PMID: 20404198
  22. Loss of Arp2/3 function led to defects in cell adhesion and actin assembly at the junction with the target cell (the lytic synapse) PMID: 19913427
  23. Arp2/3 complex is required for actin polymerization during platelet shape change. PMID: 12036877
  24. Platelets activate Arp2/3 complex, assemble actin, and change shape in the absence of WASp, indicating a more specialized role for WASp in these cells. PMID: 12200375
  25. Results suggest that recruitment of factors by Wiskott-Aldrich Syndrome protein (WASP) and Scar1 stimulates cellular actin-based motility and actin nucleation with the Arp2/3 complex. PMID: 12429845
  26. Arp2/3 complex contribution to actin filament nucleation in platelets and fibroblasts importantly requires free barbed ends generated by severing and uncapping. PMID: 12464680
  27. cortactin links receptor endocytosis to actin polymerization by binding both CD2AP and the Arp2/3 complex, which may facilitate the trafficking of internalized growth factor receptors PMID: 12672817
  28. ARP3-mediated actin polymerization is regulated by phosphorylation of the WASP protein. PMID: 12791263
  29. The interaction between cortactin and Arp2/3 complex plays an important role in S1P-mediated remodeling of endothelial cells. PMID: 15242766
  30. Arp2/3 complex genes have roles in actin organization and possibly in cancer phenotypes PMID: 15279900
  31. existence of an Arp2/3 complex-dependent event during the early phase of the life cycles of both primate lentiviruses and intracellular mature vaccinia virus PMID: 15385624
  32. signalling pathways leading to Arp2/3-dependent actin nucleation play an important role in Salmonella typhimurium invasion, but are not involved in intracellular Salmonella-induced actin assembly PMID: 15469433
  33. T-plastin increases Arp2/3-mediated actin-based movement PMID: 15741236
  34. These results indicate that interaction between the Arp2/3 complex and WASP stimulates actin polymerization and integrin beta-1-mediated adhesion during MCP-1-induced chemotaxis of THP-1 cells. PMID: 16004967
  35. the binding of the C terminus of SPIN90 with both the Arp2/3 complex (actin-related proteins Arp 2 and Arp 3) and G-actin activates the former, leading to actin polymerization PMID: 16253999
  36. in activation of the Arp2/3 complex, the C domain first primes the complex by inducing a necessary conformational change and then initiates nucleus assembly by bringing an actin monomer into proximity of the primed complex PMID: 16403731
  37. signal-induced relief of the autoinhibited fold of IQGAP1 allows activation of N-WASP to stimulate Arp2/3-dependent actin assembly PMID: 17085436
  38. Taken together, our data suggest that Apr3 should play an important role in ATRA signal pathway. PMID: 17524364
  39. p120 depletion led to dramatic loss of cortactin and its partner, Arp3, from the cell leading edges PMID: 17576929
  40. Results suggest that WAVE and the Arp2/3 complex jointly orchestrate different types of actin-based plasma membrane protrusions by promoting ruffling and inhibiting mDia2-induced filopodia. PMID: 18516090
  41. the exchange rate of N-WASP controls the rate of ARP2/3-complex-dependent actin-based motility by regulating the extent of actin polymerization by antagonizing filament capping PMID: 19262673
  42. The Arp2/3 complex, an actin-nucleating factor, is recruited at the ring structure and is important for parasite entry. PMID: 19286135

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton. Cell projection. Nucleus. Note=In pre-apoptotic cells, colocalizes with MEFV in large specks (pyroptosomes) (PubMed:19109554).
Protein Families
Actin family, ARP3 subfamily
Database Links

HGNC: 170

OMIM: 604222

KEGG: hsa:10096

STRING: 9606.ENSP00000263238

UniGene: Hs.433512

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*