Recombinant Human Activated RNA polymerase II transcriptional coactivator p15 (SUB1)

Code CSB-EP022915HU
Abbreviation Recombinant Human SUB1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SUB1
Uniprot No.
Research Area
Transcription
Alternative Names
Activated RNA polymerase II transcriptional coactivator p15; Interferon related developmental regulator 1; MGC102747; p14; P15; PC4; PC4 LSB; Positive cofactor 4; RPO2TC1; Sub1; SUB1 homolog; TCP4_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-127aa
Target Protein Sequence
PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
Gene References into Functions
  1. Study shows that PC4 might repress RNA pol II recruitment and transcription of replication-dependent histone genes in order to maintain the balance between histone gene expression and DNA synthesis. Moreover, PC4 might promote the interaction of cleavage and polyadenylation complex with histone pre-mRNAs, that might impede with the recruitment of histone cleavage complex. PMID: 30053800
  2. REVIEW: many evidences showed that Sub1 influences processes downstream during mRNA biogenesis, such as elongation, termination, and RNAPII phosphorylation. The recent discovery that Sub1 directly interacts with the RNAPII stalk adds new insights into how it achieves all these tasks. PMID: 28853990
  3. Evolutionarily conserved role for Sub1 and PC4 in the maintenance of yeast and human genome stability has been summarized. (Review) PMID: 28567479
  4. Yeast Sub1 and human PC4 are G-quadruplex binding proteins that suppress genome instability at co-transcriptionally formed G4 DNA. PMID: 28369605
  5. Results show elevated expression of SUB1 in aggressive prostate cancer. Knockdown of SUB1 in prostate cancer cells resulted in reduced cell proliferation, invasion and migration. PMID: 27270442
  6. these data provide a novel mode of PC4 binding to a DNA secondary structure that remains within the framework of the model for binding to ssDNA. Additionally, consideration of the PC4-G4DNA interaction could provide insight into the biological functions of PC4, which remain incompletely understood. PMID: 28416612
  7. PC4 associates with Aurora A and Aurora B and undergoes phosphorylation, following which PC4 activates both Aurora A and B to sustain optimal kinase activity to maintain the phosphorylation gradient for the proper functioning of the mitotic machinery. PMID: 26777301
  8. PC4 has similar functions to RPA in binding ssDNA to promote genome stability, especially at sites of replication-transcription collisions. PMID: 25961912
  9. SMYD3 interacts with the human positive coactivator 4 (PC4) and that such interaction potentiates a group of genes whose expression is linked to cell proliferation and invasion. PMID: 26350217
  10. Sub1, and its human homolog PC4, bind preferentially to G-quadruplexes PMID: 25813861
  11. expression of PC4 in astrocytoma was upregulated as assessed by western blot and immunohistochemical staining. Moreover, elevated PC4 expression was strongly correlated with the progression of astrocytoma and overall survival. PMID: 25262015
  12. PC4 protects esophageal squamous cell carcinoma cells from IR-induced death by enhancing the nonhomologous end joining-promoting activity of XLF. PMID: 25321468
  13. p38 MAP kinase mediated HNF4 Ser158 phosphorylation (P-HNF4-S158), binding of PC4 to P-HNF4-S158 and characterize the functional domain of PC4 required for P-HNF4-S158 binding. PMID: 17317687
  14. PC4 activates double-strand break (DSB) repair activity through stimulation of DSB rejoining in vivo PMID: 19038270
  15. acetylation of lysine 382/381 of p53 may play an important role in modulating p53-PC4 interaction and as a consequence PC4 mediated activation of p53 target genes. PMID: 21586571
  16. findings demonstrated a critical aspect of LHR modulation whereby PC4 acts as a coactivator of Sp1 to contribute to the human of LHR transcription PMID: 21193408
  17. Sub1/PC4 a chromatin associated protein with multiple functions in transcription. PMID: 20305379
  18. analysis of the interaction between the transactivation domain of p53 and PC4 PMID: 19525231
  19. PC4 interacts with the DNA binding and C-terminal domains of p53 through its DNA binding domain, which is essential for the stimulation of p53 DNA binding. PMID: 17785449
  20. PC4 interacts with heterochromatin protein 1alpha, REST/NRSF (RE1-silencing transcription factor/neuron-restrictive silencer factor) and CoREST to establish the repressed state of neural genes in nonneuronal cells. PMID: 20080105
  21. General transcription factor IIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity rather than by reducing the repressive activity of PC4 via its phosphorylation. PMID: 12590132
  22. These results establish the first physiological role of PC4 as a transcriptional coactivator. PMID: 14966284
  23. structure explains high-affinity binding of PC4 to the complementary strands of unwinding duplex DNA. PMID: 16415882
  24. These results establish PC4 as a new member of chromatin-associated protein family, which plays an important role in chromatin organization. PMID: 16982701
  25. Report recruitment of RNA polymerase II cofactor PC4 to DNA damage sites. PMID: 19047459

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Transcriptional coactivator PC4 family
Database Links

HGNC: 19985

OMIM: 600503

KEGG: hsa:10923

STRING: 9606.ENSP00000265073

UniGene: Hs.229641

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*