Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)

Code CSB-RP006544h
Abbreviation Recombinant Human AROS protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RPS19BP1
Uniprot No.
Research Area
Cell Biology
Alternative Names
40S ribosomal protein S19 binding protein 1; 40S ribosomal protein S19-binding protein 1; Active regulator of SIRT1; AROS ; AROS_HUMAN; Homolog of mouse S19 binding protein; Ribosomal protein S19 binding protein 1; RPS19 binding protein 1 ; RPS19-binding protein 1; RPS19BP1; S19BP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-145aa
Target Protein Sequence
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.4kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.
Gene References into Functions
  1. AROS is a significant biomarker for tumor aggressiveness in non-cirrhotic hepatocellular carcinoma. PMID: 26339164
  2. In vitro SIRT1 activity assays disclose AROS as an inhibitor of SIRT1. PMID: 24681097
  3. study demonstrated a cancer-specific role for AROS in the regulation of survival in a panel of human cell lines; data suggest that AROS, as well as SIRT1, promotes survival in cancer cells while being redundant for viability in non-cancer cells PMID: 24258275
  4. This study analyses Sirt1 modulation by several putative Sirt1 regulators, showing that the regulator protein AROS has an unusual conformation and that the Sirt1 catalytic domain is sufficient for modulation by resveratrol. PMID: 23548308
  5. we found that the SIRT1 modulators AROS and DBC1 have an impact on hsp70 transcription, HSF1 acetylation status, and HSF1 recruitment to the hsp70 promoter. PMID: 23349863
  6. Active regulator of SIRT1 (AROS) is the first direct SIRT1 regulator to be identified that modulates p53-mediated growth regulation. PMID: 17964266

Show More

Hide All

Subcellular Location
Nucleus, nucleolus.
Protein Families
AROS family
Tissue Specificity
Widely expressed (at protein level).
Database Links

HGNC: 28749

OMIM: 610225

KEGG: hsa:91582

STRING: 9606.ENSP00000333948

UniGene: Hs.526933

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*