Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial

In Stock
Code CSB-YP867185HUa4
Abbreviation Recombinant Human ADGRL3 protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Calcium-independent alpha-latrotoxin receptor 3;Latrophilin-3;Lectomedin-3
Species
Homo sapiens (Human)
Source
Homo sapiens (Human)
Expression Region
20-425aa
Target Protein Sequence
FSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in cell-cell adhesion and neuron guidance via its interactions with FLRT2 and FLRT3 that are expressed at the surface of adjacent cells. Plays a role in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex.
Gene References into Functions
  1. An ultraconserved brain-specific enhancer within LPHN3 is associated with ADHD susceptibility. PMID: 27692237
  2. Associations between LPHN1 and LPHN3 polymorphisms and severity of bronchial hyper-responsiveness in asthmatics were conducted; however, no associations were found. PMID: 27325752
  3. Results suggest that UNC5 and LPHN3 can simultaneously bind to FLRT3, forming a trimeric complex, and that FLRT3 may form transsynaptic complexes with both LPHN3 and UNC5. PMID: 26235030
  4. LPHN3 confers ADHD susceptibility, and moderates methylphenidate treatment response in children and adolescents with ADHD. PMID: 25989180
  5. Study examined the association between the LPHN3 rs6551665 A/G polymorphism and Attention deficit hyperactivity disorder (ADHD) in Korea; samples used in the study consisted of 150 ADHD children and 322 controls; ADHD children appeared to have a surplus of GG genotype, studies with larger sample sizes needed. PMID: 25871512
  6. genetic association studies in Germany: Data suggest that, within a sample of patients with attention deficit disorder hyperactivity, SNPs in LPHN3 gene impacts behavioral and neurophysiological measures of cognitive response control. PMID: 23245769
  7. Increased LPHN3 mRNA expression levels correlated with axillary-node metastasis in breast cancer. PMID: 23317273
  8. The influence of LPHN3 genotype on attention deficit-hyperactivity disorder (ADHD) and addiction is mediated through alterations in transgenic monoamine signaling. PMID: 22575564
  9. A two-locus genetic interaction between LPHN3 and 11q predicts ADHD severity and long-term outcome. PMID: 22832519
  10. This study identifying loci for aADHD and led to the identification of LPHN3 as novel genes associated with ADHD across the lifespan. PMID: 22105624
  11. highly significant interaction between four SNPs and maternal stress during pregnancy and development of attention-deficit/hyperactivity disorder PMID: 22486528
  12. single-nucleotide polymorphisms harbored in the LPHN3 gene interact with SNPs spanning the 11q region that contains DRD2 and NCAM1 genes, to double the risk of developing ADHD. PMID: 21606926
  13. This study demonistrated that LPHN3 and its ligand FLRT3 play an important role in glutamatergic synapse development. PMID: 22405201
  14. LPHN3, a new gene in which variants have recently been shown to be associated with adhd. PMID: 21432600
  15. These results further support the LPHN3 contribution to combined type ADHD, and specifically to the persistent form of the disorder PMID: 21040458
  16. The mutational analysis of the entire coding region of LPHN3 in a cohort of 139 attention deficit hyperactivity disorder subjects and 52 controls, is reported. PMID: 21184580

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell junction.
Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Database Links

HGNC: 20974

OMIM: 616417

KEGG: hsa:23284

STRING: 9606.ENSP00000422533

UniGene: Hs.28391

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*