Recombinant Human Aldehyde dehydrogenase X, mitochondrial (ALDH1B1), partial

Code CSB-EP001568HU1
Abbreviation Recombinant Human ALDH1B1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ALDH1B1
Uniprot No.
Research Area
Metabolism
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
167-264aa
Target Protein Sequence
SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Gene References into Functions
  1. These results suggest that ALDH1B1 is a novel human colorectal cancer biomarker PMID: 28881356
  2. The aims of this study were: (i) to use bioinformatic techniques to characterize the possible effects of selected variants in ALDH1B1 on protein structure and function; and, (ii) to genotype three missense and one stop-gain, protein-altering, non-synonymous single nucleotide polymorphisms in 1478 alcohol dependent cases and 1254 controls of matched British and Irish ancestry. PMID: 28594837
  3. ALDH1B1 is expressed at very high levels in human pancreatic cancer, and it contributes to proliferation in these tumor cells. PMID: 26566217
  4. High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients. PMID: 26366059
  5. Data show that ALDH1B1 may promote colon cancer tumorigenesis by modulating the Wnt/beta-catenin, Notch and PI3K/Akt signaling pathways. PMID: 25950950
  6. ALDH1B1 metabolizes nitroglycerin and all-trans-retinaldehyde. One of the three human polymorphisms, ALDH1B1*2, is catalytically inactive, likely due to poor NAD(+) binding. PMID: 25413692
  7. ALDH1B1 SNPs play a role in shaping the alcohol drinking patterns among the Inuit in Greenland. PMID: 25311581
  8. ALDH1 is indicative of stemness and is a biomarker marker in colon cancer. PMID: 24953984
  9. ALDH1B1 is more profoundly expressed in the adenocarcinomas examined in this study relative to ALDH1A1 and that ALDH1B1 is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer. PMID: 21216231
  10. An ALDHX model based on the crystal structure of human ALDH2, reveals similarities with the previously described ALDH structures. Analyses indicate a close structural and functional relationship between the two isoenzymes of human origin PMID: 20955166
  11. a common SNP encoding ALDH1b1 (rs2228093) was found to be significantly associated with alcohol-induced hypersensitivity. PMID: 20205700
  12. ALDH1b1 ala69val was associated with diastolic blood pressure in a Caucasian population sample PMID: 18782342

Show More

Hide All

Subcellular Location
Mitochondrion matrix.
Protein Families
Aldehyde dehydrogenase family
Tissue Specificity
Liver, testis and to a lesser extent in brain.
Database Links

HGNC: 407

OMIM: 100670

KEGG: hsa:219

STRING: 9606.ENSP00000366927

UniGene: Hs.436219

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*