Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2)

In Stock
Code CSB-EP618761HU
Abbreviation Recombinant Human AIMP2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Aimp2; AIMP2_HUMAN; Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 ; ARS interacting multi functional protein 2 ; JTV 1; JTV 1 protein; JTV1; JTV1 gene; Multisynthase complex auxiliary component p38; Multisynthetase complex auxiliary component p38; P38; PRO0992; Protein JTV 1; Protein JTV-1; tRNA SYNTHETASE COFACTOR p38
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-320aa
Target Protein Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human AIMP2 protein is a fusion protein consists of the human AIMP2 protein (1-320aa) partnered with the N-terminal 6xHis tag. It was produced in the E.coli. This recombinant AIMP2 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 30 kDa protein band presented on the gel.

AIMP2 protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. AIMP2 had an inhibitory effect on neoplasms, which could increase the tumor necrosis-induced signaling apoptosis. AIMP2 can directly interact with and activate PARP1. Both AIMP2 and α-synuclein are components of Lewy bodies. Likewise, activated PARP1 can regulate several pathological mechanisms in PD, including the aggregation of α-synuclein, mitochondria dysfunction, and mitophagy dysregulation. AIMP2 also inhibits editing by decreasing ADAR protein levels. Recent evidence indicates that PARP1 activation is a necessary early event in DA neuronal cell death induced by 6-OHDA, consistent with the fact that AIMP2-mediated activation of PARP1 is one of the main causes for the loss of DA neurons.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
Gene References into Functions
  1. AIMP2-DX2 plays an important role in the regulation of Nasopharyngeal carcinoma. PMID: 29854811
  2. Homozygosity for a nonsense variant in AIMP2 is associated with a progressive neurodevelopmental disorder with microcephaly, seizures, and spastic quadriparesis. PMID: 29215095
  3. These findings provide new mechanistic insights into the role of VPS35 in the regulation of AIMP2 levels and cell death. PMID: 28383562
  4. AIMP2 underexpression is associated with lung neoplasms. PMID: 27197155
  5. our findings show how DX2 promotes lung cancer progression and how its activity may be thwarted as a strategy to treat patients with lung cancers exhibiting elevated DX2 levels PMID: 27302160
  6. These data indicate monomer-dimer equilibrium of AIMP2-DX2 in solution. These results form the basis for the structure-function study of oncogenic AIMP2-DX2. PMID: 28185908
  7. analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3 PMID: 26472928
  8. Ubiquitin and SUMO compete for the same lysine (K242) on influenza A virus M1 and the interaction of viral NS2 with human AIMP2 facilitates the switch of the M1 modification from ubiquitination to SUMOylation, thus increasing viral replication. PMID: 25320310
  9. These findings suggested that, although excessive accumulation of oxidative DNA damage was present in LSCs, the relatively decreased phosphorylation of p38 might help leukemic cells escape senescence and apoptosis. PMID: 22684553
  10. Transgeneic overexpression of AIMP2 led to a selective, age-dependent, progressive loss of dopaminergic neurons. PMID: 23974709
  11. The tumorigenic activity of AIMP2-DX2 can be controlled by the small chemical BC-DXI01, which can selectively suppress the AIMP2-DX2 mRNA transcript. PMID: 23815603
  12. AIMP2-DX2, a splicing variant of tumor suppressor AIMP2, can be a therapeutic target to control chemoresistant epithelial ovarian cancer . PMID: 22532625
  13. downregulation of AIMP2 lacking exon 2 (AIMP2-DX2), expressed in different cancer cells, suppressed the epidermal growth factor receptor/mitogen activated protein kinase signaling pathway PMID: 22562359
  14. ribozyme could selectively deliver the activity of a suicide gene into the AIMP2-DX2 RNA expressing lung cancer cells and thereby specifically and effectively retard the growth of the cancer cells with prodrug treatment. PMID: 22285955
  15. a splicing variant of AIMP2 lacking exon 2 (AIMP2-DX2) is highly expressed by alternative splicing in human lung cancer cells and patient's tissues PMID: 21483803

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Nucleus.
Database Links

HGNC: 20609

OMIM: 600859

KEGG: hsa:7965

STRING: 9606.ENSP00000223029

UniGene: Hs.301613

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*