Recombinant Human Aminoacylase-1 (ACY1)

Code CSB-EP860799HU
Abbreviation Recombinant Human ACY1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ACY1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
ACY 1; ACY-1; Acy1; ACY1_HUMAN; ACY1D; ACYLASE; Acylase I; Aminoacylase 1; Aminoacylase-1; EC 3.5.1.14; epididymis secretory protein Li 5; HEL-S-5; N acyl L amino acid amidohydrolase; N-acyl-L-amino-acid amidohydrolase; OTTHUMP00000212459; OTTHUMP00000212462; OTTHUMP00000212463; OTTHUMP00000212464; OTTHUMP00000212465
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-408aa
Target Protein Sequence
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
72.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the hydrolysis of N-acetylated amino acids to acetate and free amino acids.
Gene References into Functions
  1. with the elevated level in the disease progression of Chronic hepatitis B (CHB), ACY1 autoantibody may be a valuable serum biomarker for discriminating HBVrelated liver cirrhosis from CHB. PMID: 27633755
  2. Biochemical analysis showed absence of ACY1 enzyme activity in the patient's fibroblasts. PMID: 24117009
  3. ACY1 acts as a tumor suppressor in hepatocellular carcinoma. PMID: 24846301
  4. Report serum aminoacylase-1 as a novel biomarker with potential prognostic utility for long-term outcome in renal transplant recipients with delayed graft function. PMID: 23739232
  5. Case Report: ACY1-deficient patient presenting with autistic features. PMID: 20480396
  6. We concluded that ACY1 expression in colorectal cancer varies with stage and appears to play a role in cell proliferation and apoptosis PMID: 23317546
  7. These data suggest that aminoacylase expression is dysregulated in neuroblastoma. PMID: 21128244
  8. aminoacylase 1 proteins with the mutations p.Arg378Trp, p.Arg378Gln and p.Arg393His were also detected in Western blot analysis PMID: 21414403
  9. by complementing different active site mutants of human aminoacylase-1, study shows that catalysis occurs at the dimer interface PMID: 12933810
  10. first report of a patient with aminoacylase I deficiency PMID: 16274666
  11. Genetic deficiency of ACY1 leads to functional ACY1 deficiency and excretion of N-acetylated amino acids. PMID: 16465618
  12. Because hK1 amidase activity is significantly lower in urine of systolic HF patients, it can be supposed that activity of renal kallikrein-kinin system may be suppressed in this systolic heart failure. PMID: 17045186
  13. T347S variant of human Acy1 exhibited markedly increased catalytic efficiency against N-benzoylamino acids PMID: 18341290

Show More

Hide All

Involvement in disease
Aminoacylase-1 deficiency (ACY1D)
Subcellular Location
Cytoplasm.
Protein Families
Peptidase M20A family
Tissue Specificity
Expression is highest in kidney, strong in brain and weaker in placenta and spleen.
Database Links

HGNC: 177

OMIM: 104620

KEGG: hsa:95

STRING: 9606.ENSP00000384296

UniGene: Hs.334707

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*