Recombinant Human Angiopoietin-related protein 6 (ANGPTL6), partial

Code CSB-YP822824HU
Abbreviation Recombinant Human ANGPTL6 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ANGPTL6
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Angiopoietin-like protein 6;Angiopoietin-related growth factor;Angiopoietin-related protein 5
Species
Homo sapiens (Human)
Source
Homo sapiens (Human)
Expression Region
251-470aa
Target Protein Sequence
TKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.0 kDa
Protein Length
Partial
Tag Info
N-terminal ZNRF3-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the wound healing process. May promote epidermal proliferation, remodeling and regeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteract high-fat diet-induced obesity and related insulin resistance through increased energy expenditure.
Gene References into Functions
  1. rare coding variants in ANGPTL6 are causally related to familial forms of Intracranial aneurysms. PMID: 29304371
  2. Poor glycemic control in diabetes mellitus as reflected by higher serum HbA1c levels is associated with raised serum ANGPTL6 levels PMID: 29033485
  3. ANGPTL6, S100A8 and S100A9 are overexpressed in skin of psoriasis patients versus zero expression in controls. PMID: 27698489
  4. Data suggest that serum AGF levels are up-regulated in type 2 diabetic patients with lower extremity peripheral arterial disease according to disease severity; patients with highest serum AGF levels exhibit increased cardiovascular mortality and all-cause mortality. PMID: 27866700
  5. Serum ANGPTL6 levels increased in patients with a hypothyroid status, and both TSH and free T4 levels are associated with ANGPLT6 levels, suggesting a possible association between thyroid function and ANGPTL6 levels. PMID: 26189599
  6. AGF concentrations is significantly higher in patients with type 2 diabetes as compared to controls. PMID: 25011017
  7. In the second trimester, Angptl6 levels are higher in women with subsequent pregnancy-induced hypertension. PMID: 23905605
  8. There are no significant differences in maternal Angptl6/ARP5 serum level between pre-eclamptic women and normally pregnant control women PMID: 23718665
  9. Serum AGF levels are significantly higher in subjects with polycystic ovary syndrome than those in the healthy control group. PMID: 22406517
  10. Interaction between alpha6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6. PMID: 23070965
  11. ANGPTL6 affects resting metabolic rate (RMR), significantly improves lipid profile and slightly improves insulin levels and insulin sensitivity, as well. PMID: 21460784
  12. serum AGF levels were paradoxically increased in metabolic syndrome, in comparison with data from animal experiments and data on sex, age, and waist circumference PMID: 20673930
  13. findings suggest that AGF affects epidermal proliferation and thereby plays a role in the wound healing process PMID: 12871997
  14. showed that AGF is a secreted protein, AGF directly promotes chemotactic activity of vascular endothelial cells, and AGF directly induces a permeability change in the local vasculature. PMID: 14764539
  15. Our results strongly suggest that AGF is an integrin ligand as well as a mitogenic growth factor and theoretically participates in cutaneous wound healing in a more complex mechanism. PMID: 16806062
  16. study of associations between ANGPTL6 polymorphisms and metabolic syndrome or related phenotypes in a French population PMID: 19447061

Show More

Hide All

Subcellular Location
Secreted.
Database Links

HGNC: 23140

OMIM: 609336

KEGG: hsa:83854

STRING: 9606.ENSP00000253109

UniGene: Hs.712850

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*