Recombinant Human Apolipoprotein B-100(APOB),partial

Code CSB-YP001918HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P04114
Relevance Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Apolipoprotein B-48 Short name: Apo B-48
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Research Area Cardiovascular
Source Yeast
Gene Names APOB
Protein Names Recommended name: Apolipoprotein B-100 Short name= Apo B-100 Cleaved into the following chain: 1. Apolipoprotein B-48 Short name= 2. Apo B-48
Expression Region 28-127aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Involvement in disease Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Subcellular Location Cytoplasm, Secreted
Database Links

HGNC: 603

OMIM: 107730

KEGG: hsa:338

STRING: 9606.ENSP00000233242

UniGene: Hs.120759

Pathway Cholesterol metabolism

Related Products

APOB Antibodies

APOB Antibodies for Homo sapiens (Human)

APOB Proteins

APOB Proteins for Homo sapiens (Human)

APOB ELISA Kit

APOB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.