Recombinant Human Apolipoprotein B-100(APOB),partial

Code CSB-YP001918HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names APOB
Uniprot No. P04114
Research Area Cardiovascular
Alternative Names Apo B 100; Apo B; Apo B-100; Apo B-48; Apo B100; Apo B48; ApoB 100 ; ApoB 48; APOB; APOB_HUMAN; Apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; Apolipoprotein B; Apolipoprotein B-48; Apolipoprotein B100; Apolipoprotein B48; FLDB; LDLCQ4
Species Homo sapiens (Human)
Source Yeast
Expression Region 28-127aa
Target Protein Sequence EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 13.2kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Gene References into Functions
  1. Authors performed an analysis of public databases and literature for every variant published associated with FH, in the genes LDLR, APOB, and PCSK9. PMID: 29261184
  2. Targeted next generation DNA sequencing revealed several rare heterozygous missense variants in both MTTP and APOB genes known or predicted to be deleterious, in addition to a novel heterozygous missense variant in SAR1B, which encodes the gene causing chylomicron retention disease PMID: 29540175
  3. Single nucleotide polymorphisms rs693 and rs6725189 of the apoB gene are associated with calcific aortic stenosis in Chinese subjects, in Xinjiang, China. PMID: 29514644
  4. In conclusion, this study demonstrated that an APOB SNP, rs1042034, is closely associated with HCV infection through lipid metabolism alteration. PMID: 29382324
  5. APOB rs11279109 is associated with increased risk of coronary heart disease in Kuwaiti population. PMID: 29362515
  6. The simultaneous retention of fibrinogen and APOB-lipoproteins in FSD can be detected in routinely stained histological sections. The analysis of protein structures unraveled the pathomorphogenesis of this unexpected phenomenon. Fibrinogen gamma chain mutations provoke conformational changes in the region of the globular domain involved in the "end-to-end" interaction, thus impairing the D-dimer formation PMID: 29244742
  7. APOB polymorphism rs679899 is associated with type 2 diabetes and glutamyl transpeptidase levels, while the LIPC polymorphism rs6083 may influence plasma lipid levels in Chinese Han population. PMID: 29883758
  8. We present a case of homozygous familial defective apolipoprotein B-100 due to APOB R3500Q (rs5742904) treated with evolocumab ..Identification of a patient homozygous for familial defective apolipoprotein B-100(FDB) and successful treatment with PCSK9 inhibition PMID: 28988723
  9. Increased LDL levels were observed over time in patients with the -7673G>A polymorphism of the ApoB gene. PMID: 29846435
  10. Review/Meta-analysis: significant association of APOB rs1801701 GA, and APOB rs1042031 GA with increased risk of ischemic stroke. PMID: 28865324
  11. Serum apoB/A-I ratio appears to have value for predicting SAP in patients with AP. PMID: 28677336
  12. Apolipoprotein B is associated with carotid atherosclerosis progression PMID: 28826575
  13. Results show differences in the apoB100 secondary structure content among lipoproteins incubated at pH 7.4 or at pH 5.0 that could resemble those occurring in the early or late endosomes, respectively. PMID: 27824107
  14. Elevated serum apoB levels independently predict an increased risk for incident non-alcoholic fatty liver disease. PMID: 28106941
  15. This study shows that the ApoB-516C/T promoter gene polymorphism has no impact on the risk of hepatitis C virus infection. However, the C/T genotype may be a protective factor for females. PMID: 28370191
  16. association of TM6SF2 rs58542926 genotype with increased serum tyrosine levels and decreased apoB-100 particles in Finns PMID: 28539357
  17. that apos involved in TG metabolism such as apoC2, C3, E, and A4 (micromolar concentration), and apoB48 and apoA5 (single-digit nanomolar concentration) can be quantified from a single digestion mixture. PMID: 24694356
  18. These findings indicate that maternal apo B levels are significantly associated with apo B levels in their pre-school age children, adjusted for confounding variables. Furthermore, the mother-child correlations in apo B levels were independent of mother-child adiposity. Measurement of apo B levels in mothers may identify both high-risk children and mothers who may benefit from intervention. PMID: 28799493
  19. Individuals with apoB higher than predicted by non-HDL-C had significantly higher levels of PAI-1, which may contribute to the increased risk of future atherothrombotic events PMID: 28502501
  20. analysis of five likely pathogenic heterozygous rare variants that include four novel nonsense mutations in APOB (p.Gln845*, p.Gln2571*, p.Cys2933* and p.Ser3718*) and a rare variant in PCSK9 (Minor Allele Frequency <0.1%). PMID: 27179706
  21. In this sample of older adults with mild cognitive impairment, the presence of at least one copy of ApoE4 was associated with the development of both increased gait variability and cognitive decline during 1 year of follow-up PMID: 28482102
  22. The impact of smoking on the levels of apolipoprotein B (APOB) was evaluated by analyzing data from NHANES for the years 2007-2012 for US adolescents aged 12-19 years and adults aged greater than or eqult to 20 years. The study found that smoking did not influence the observed levels of APOB for either adolescents or adults. PMID: 28672200
  23. Identify LDLR, APOB and PCSK9 novel mutations causing familial hypercholesterolemia in the central south region of China. PMID: 28235710
  24. Rare variants of APOB or PCSK9 were identified in nine of the 22 study patients with extremely low LDL-C levels PMID: 29036232
  25. Eicosapentaenoic acid has direct antioxidant benefits in various apoB-containing subfractions. PMID: 26945158
  26. Association of plasma apoB with IR in obese subjects is dependent on gynoid WAT dysfunction PMID: 28391908
  27. Serum ApoB was not significantly different between term SGA newborns and control term newborns. PMID: 28304324
  28. APOB associated with Familial Hypercholesterolemia and Polygenic Hypercholesterolemia in patients with Acute Coronary Syndrome , age /=160 mg/dl. PMID: 28958330
  29. we identified common intronic SNPs (rs676210 and rs1042034) in the APOB gene and found five SNPs that were collectively associated with hyperlipidemia in the adult Chinese Yugur population. Importantly, we demonstrated that the G allele of rs676210 may confer an increased risk of hyperlipidemia. PMID: 28902930
  30. APOB missense variants, A224T and V925L, in a black South African woman with marked hypocholesterolemia PMID: 27206948
  31. male gender, ageing in women and menopause were associated with increased apoB concentrations. PMID: 27086565
  32. Data provide no evidence supporting an association between the APOB R3527Q variant and type 2 diabetes or glycemia. PMID: 28428224
  33. Levels of lipoprotein (a) [Lp(a)], a complex between an LDL-like lipid moiety containing one copy of apoB, and apo(a), a plasminogen-derived carbohydrate-rich hydrophilic protein, are primarily genetically rIncreasing evidence suggests that age, sex, and hormonal impact may have a modest modulatory influence on Lp(a) levels. Among clinical conditions, Lp(a) levels are reported to be affected by kidney and liver diseases. PMID: 26637279
  34. Data suggest that amphipathic beta-strands in 200 N-terminal residues of beta1 domain of APOB are required for secretion of lipid-rich or lipid-poor particles; residues 300-700 or 1050-1500 of beta1 domain appear to be required for secretion of lipid-rich particles; MTTP is required for secretion of intact APOB but not of truncated APOB. (APOB = apolipoprotein B; MTTP = microsomal triglyceride transfer protein) PMID: 28702990
  35. Basal apoB secretion by BeWo cells supports the concept of basal lipoprotein particle secretion by placental syncytiotrophoblast. PMID: 28487135
  36. ApoB EcoRI confers a moderate risk for coronary heart disease and the E(-) allele at this locus might be a susceptibility allele for the development of disease (Meta-Analysis) PMID: 27637205
  37. APOB single nucleotide polymorphism and it's association with LDL cholesterol level and risk of coronary heart disease in Pakistani population PMID: 27112212
  38. High apoB48 concentration is associated with Atherosclerotic Lesion Progression. PMID: 27487947
  39. Autoantibodies to oxidized lipoproteins and immune complexes with apoB-100 lipoproteins vary significantly by sex, age, and ethnicity. Higher baseline IgG MDA-LDL titers independently associate with new major adverse cardiovascular events. PMID: 28473443
  40. miR-548p regulates apoB secretion by targeting its mRNA degradation. PMID: 28336556
  41. Adolescent girls with obesity and polycystic ovary syndrome have elevated fasting and postprandial plasma triglycerides and ApoB-lipoprotein remnants. PMID: 27997268
  42. the associations of rs693 and rs562338 polymorphisms representing the Apolipoprotein B locus with endophenotypes (total cholesterol [TC] and high-density lipoprotein cholesterol) and phenotypes, were examined. PMID: 27683205
  43. ApoB100 is indispensable for HCV infection. ApoB is required for the generation of fully infectious HCV virions. PMID: 28018102
  44. a higher inflammatory status is associated with decreased triglyceride-rich-rich lipoprotein apoB-48 secretion among insulin resistant subjects PMID: 28183448
  45. Several protein markers were also deregulated in extracellular vesicless from bladder tumour patients, and our data suggest that the presence of ApoB in the 100,000 pellet is a clear marker for malignancy. PMID: 27751843
  46. 10 association studies for Han Chinese, with 1195 CHD patients and 1178 healthy subjects, we found that XbaI (rs693) polymorphisms in APOB were statistically significantly associated with Coronary Heart Disease in Han Chinese population PMID: 27172140
  47. We observed a significant interaction between Ins/Del ApoB genotype and dietary omega-3 PUFA intake with respect to BMI, WC, and obesity risk in both unadjusted (P = 0.007, P = 0.001, and P = 0.021, respectively) and adjusted (P = 0.007, P = 0.04, and P = 0.002, respectively) samples in NIDDM patients. PMID: 27210509
  48. Multiple novel LDLR and ApoB mutations have been identified in a-United Kingdom-based cohort with familial hypercholesterolemia. PMID: 26748104
  49. Data suggest that LDL-C/apoB ratio (ratio of plasma level of total cholesterol to plasma level of apolipoprotein B) is an important biomarker in overall evaluation of atherogenicity in obese, overweight, and normal-weight men; this study of qualitative changes in lipid/lipoprotein profile for early diagnosis of dyslipidemias leading to atherosclerosis was conducted in Russia. PMID: 27347637
  50. Mutations in APOB is associated with hypobetalipoproteinemia. PMID: 26916057
  51. LDLR A(+)A(+) genotype, ApoB X(+) allele and ApoE E4 allele increased the risk of premature coronary artery disease by 1.8, 2.1 and 12.1 respectively. PMID: 27236033
  52. C7673T polymorphism in apoB gene is significantly associated with increased ischemic stroke risk in the Chinese population. PMID: 26004908
  53. Apo-B correlation with both LDL-C and non-HDL-C is reduced in individuals with high TG levels and in particular for those with diabetes or MetS. PMID: 26868509
  54. Report increased intestinal cholesterol absorption and elevated serum cholesterol in families with primary hypercholesterolemia without mutations in APOB. PMID: 26802983
  55. associations between apolipoprotein B, A1, and the B/A1 ratio and nonalcoholic fatty liver disease in both normal-weight and overweight Korean population PMID: 27055959
  56. Serum LAB was associated with an increased carotid IMT in Japanese men, especially those with hypercholesterolemia PMID: 26892134
  57. Low plasma concentration of PTX3 in early pregnancy is associated with subsequent development of gestational diabetes and with an enhanced risk for CVD as estimated by an elevated apoB/apoA ratio at 5 years postpartum. PMID: 26842615
  58. There was no correlation found between plasma apoB levels and hyperhomocysteinemia. PMID: 26758372
  59. Homozygosity for a rare missense mutation in the betaalpha1 domain of apoB may be the cause of both severe hypobetalipoproteinemia and intestinal lipid malabsorption. PMID: 26612772
  60. The current meta-analysis found an association of EcoRI polymorphism and SpIns/Del polymorphism with an increased risk of coronary heart disease. PMID: 26537298
  61. Report changes in the concentration of sialic acid in ApoB-containing lipoproteins in liver disease. PMID: 27468569
  62. Serum-expressed apolipoprotein B-100 protein, C9 Complement, and gelsolin can be used for differential diagnosis of Barrertts esophagus and adenocarcinoma of esophagus. PMID: 26404905
  63. Subjects with high levels of apolipoprotein B-100 autoantibodies have a lower risk of coronary events supporting a protective role of these autoantibodies in cardiovascular disease. PMID: 26916732
  64. apo(a) has a plasma residence time (11days) that is more than twice as long as that of apoB-100 (4days) within Lp(a) PMID: 26975530
  65. ApoB improves risk assessment of future coronary heart disease events over and beyond LDL-C/non-HDL-C, suggesting coronary risk is more closely related to the number of atherogenic apoB particles than to the mass of cholesterol within them. PMID: 25633587
  66. Defective secretion of the Thr26_Tyr27del mutant was associated with increased intracellular degradation of apoB through the proteasome-dependent pathway in familial hypobetalipoproteinemia. PMID: 26825690
  67. plasma apoB-to-PCSK9 ratio provides a better clinical index than PCSK9 alone for monitoring early metabolic disturbances that may be promoted by reduction in plasma PCSK9 PMID: 26350813
  68. Report improvement of mTORC1-driven overproduction of apoB-containing triacylglyceride-rich lipoproteins by 4-phenylbutyric acid and (R)-alpha-lipoic acid, in human hepatocellular carcinoma cells. PMID: 26680362
  69. The APOB XbaI and EcoRI polymorphisms are associated with blood lipids in Chinese patients with various diseases and control subjects. PMID: 26446158
  70. In African-Americans, apoB and apoB/apoA-1 remained consistently and positively associated with both Lp(a) and allele-specific apo(a) levels PMID: 24859635
  71. Our findings demonstrate a maternal-specific association between a common APOB variant and adiposity, an association that was not previously detected in GWAS. PMID: 26451733
  72. Data suggest level of ApoB in blood can be down-regulated by dietary factors; here, intake of tree nuts reduces ApoB in blood of adults aged 18 years and older; nut dose rather than nut type appears most important factor. [META-ANALYSIS, REVIEW] PMID: 26561616
  73. Dabigatran is associated with a significant ( approximately 7%) reduction in ApoB concentration, suggesting a novel effect of this drug on lipoprotein metabolism. PMID: 26552755
  74. Meta-analysis: ApoB100 antisense oligonucleotide mipomersen consistently and effectively reduced Lp(a) levels in patients with a variety of lipid abnormalities and cardiovascular risk. PMID: 25614280
  75. ApoB loss-of-function mutations causing hypobetalipoproteinemia in type 1 diabetes. PMID: 25430706
  76. Elevated apoB is associated with increased arterial stiffness in type 1 diabetes adolescents. PMID: 25539881
  77. analysis of a case of homozygous familial hypobetalipoproteinemia that is due to two splicing mutations affecting both the donor and the acceptor splice sites of the same intron of the APOB gene [case report] PMID: 25618028
  78. The aim of this study was to specifically explore LDL apoB distribution across sizes in cord blood serum. PMID: 24362269
  79. findings support significant association between the APOB rs1469513 variant, plasma lipid profiles and obesity-related phenotypes; this association has potential to be modified by dietary fat intake; results may offer proof that the differences between normal weight and overweight/obese individuals might partly result from different SNPs PMID: 25837208
  80. In statin-treated men with type 2 diabetes mellitus, niacin decreased plasma Lp(a) concentrations by decreasing the production of apo(a) and Lp(a)-apoB-100. PMID: 26515419
  81. The Janus-faced manifestations of homozygous familial hypobetalipoproteinemia due to apolipoprotein B truncations. PMID: 26073401
  82. The present study suggests the higher the apolipoprotein B levels are, the earlier an atherosclerotic stroke might occur in a Chinese population. PMID: 25120028
  83. 4F stabilizes LDL particles by preventing the SMase-induced conformational changes in apoB-100 and so blocks SMase-induced LDL aggregation and the resulting increase in LDL retention PMID: 25861792
  84. Data suggest that subjects heterozygous for L343V mutation in APOB exhibit down-regulation of TRL (triglyceride-rich lipoprotein) production with normal postprandial TRL particle clearance as compared to control subjects. PMID: 26323024
  85. The hypertriglyceridemia of type 2 diabetes mellitus patients with diabetic nephropathy is not due to hepatic VLDL-Apo B 100 overproduction PMID: 26291068
  86. High levels of IgM against MDA-p210 are associated with less severe carotid disease in women. PMID: 25768285
  87. Discordance between apoB and LDL-PNMR in routine clinical practice is more widespread than currently recognized and may be associated with insulin resistance PMID: 25911082
  88. No significant association of apoB XbaI gene polymorphism was found with obesity in an Egyptian population. PMID: 25889118
  89. The expression of apoB-100, MTP, and PDI, and the estrogen-stimulated lipoprotein secretion by BeWo cells suggest that these cells are a useful system to study aspects of lipoprotein metabolism at the placental barrier. PMID: 25765953
  90. Overexpression of SHIP2 led to a significant increase in both secretion of apoB100 containing lipoproteins and de-novo lipogenesis. PMID: 26188518
  91. ApoB is required for the assembly of cell-free infective particles, strongly suggesting the existence of mechanisms involving VLDL components that differentially regulate cell-free and cell-to-cell HCV transmission. PMID: 26202245
  92. Data indicate that patients with systemic lupus erythematosus (SLE) have decreased levels of apolipoprotein (apo) B-100 peptides p45 and p210 autoantibodies and associated with an increased risk of cardiovascular disease (CVD). PMID: 25959453
  93. The results of this study findings underlined the importance of the APOE4 allele for designing and interpreting future treatment trials in patients with AD dementia. PMID: 25391384
  94. Increase in total apolipoprotein B trended toward decreased risk for hyperuricemia. PMID: 25432151
  95. Several site-specific oxidations were identified in apo B-100 after treatment of intact low-density lipoprotein particles with the oxidants. PMID: 25176030
  96. The study reveals a novel, environment-specific genetic polymorphism of APOB that may affect key metabolic pathways contributing to diabetes in sickle cell disease. PMID: 26025476
  97. ApoBDS-1 is an effective platelet agonist, boosting platelet-leukocyte's proinflammatory responses, and potentially contributing to the multifaceted inflammatory-promoting effects of LDL in the pathogenesis of atherothrombosis. PMID: 24816772
  98. Data suggest that elevated serum apoB can be considered a nontraditional risk factor for cardiovascular disease in obese and overweight subjects in the adult population studied in China. PMID: 25159728
  99. APOB expression was increased in the coronary intima from surgically repaired congenital heart disease patients. PMID: 25201024
  100. These data indicate that anacetrapib, given alone or in combination with a statin, reduces LDL-ApoB-100 levels by increasing the rate of ApoB-100 fractional clearance. PMID: 25961461

Show More

Hide All

Involvement in disease Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Subcellular Location Cytoplasm, Secreted
Database Links

HGNC: 603

OMIM: 107730

KEGG: hsa:338

STRING: 9606.ENSP00000233242

UniGene: Hs.120759

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1