Thanks for your inquiry.
Generally, The longer the length, the more difficult it is to express. The length is 2152aa, I'm afraid the full length protein is impossible to express.
For the time being, we can offer risk-free custom service for expressing protein within 800aa,and we can try to express longer protein within 1200aa,
but the custom service for protein expression with length over 800aa is charged step by step.
1.Protein length within 800aa: Risk-free custom service
2.Protein length over 800aa but less than 1200aa: Custom service charged step by step.
3.Protein length over 1200aa: We would rather not to try, but if the customer insists, we can try to express, it's charged step by step.
In addition, could you pls tell us your application of this protein ? Do it must be the purified protein, is the lysate be OK ?
If the lysate is OK, the success rate would be much higher.
BTW, we need to choose the suitable expression region according to your application, or if you could tell us the region, that would be better.
We can try any region with the length less than 1200aa.
Previously, we have successfully developed a partial protein listed as below:
Recombinant Human Apolipoprotein B-100(APOB),partial
CSB-EP001918HUb0 >> E.coli
Expression Region: 28-127aa; Partial.
Tag information:N-terminal 10xHis-tagged.
Sequence:
EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS