Name: Recombinant Human Apolipoprotein B-100(APOB),partial
Brand: CUSABIO
SKU: CSB-EP001918HUb0

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	APOB
Uniprot No.	P04114
Research Area	Epigenetics and Nuclear Signaling
Alternative Names	Apo B 100; Apo B; Apo B-100; Apo B-48; Apo B100; Apo B48; ApoB 100 ; ApoB 48; APOB; APOB_HUMAN; Apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; Apolipoprotein B; Apolipoprotein B-48; Apolipoprotein B100; Apolipoprotein B48; FLDB; LDLCQ4
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	28-127aa
Target Protein Sequence	EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	14.7 kDa
Protein Length	Partial
Tag Info	N-terminal 10xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

■ Q&A

I'm looking for the full-length human recombinant ApoB-48 protein?

Thanks for your inquiry.
Reference: https://www.uniprot.org/uniprot/P04114
The full-length human recombinant ApoB-48 protein refers to the region of 28-2179aa, the length is 2152aa, which is too difficult to express, sorry, we can't provide.Do you accept the partial protein ? If yes, please tell us the fragment of interest, we will check if we can provide.

Thank you for your response, I'm wondering what the maximum length of the ApoB-48 protein you can produce? I'm looking for a protein that is as complete as possible.

Thanks for your inquiry.
Generally, The longer the length, the more difficult it is to express. The length is 2152aa, I'm afraid the full length protein is impossible to express.
For the time being, we can offer risk-free custom service for expressing protein within 800aa,and we can try to express longer protein within 1200aa,
but the custom service for protein expression with length over 800aa is charged step by step.
1.Protein length within 800aa: Risk-free custom service
2.Protein length over 800aa but less than 1200aa: Custom service charged step by step.
3.Protein length over 1200aa: We would rather not to try, but if the customer insists, we can try to express, it's charged step by step.
In addition, could you pls tell us your application of this protein ? Do it must be the purified protein, is the lysate be OK ?
If the lysate is OK, the success rate would be much higher.
BTW, we need to choose the suitable expression region according to your application, or if you could tell us the region, that would be better.
We can try any region with the length less than 1200aa.
Previously, we have successfully developed a partial protein listed as below:
Recombinant Human Apolipoprotein B-100(APOB),partial
CSB-EP001918HUb0 >> E.coli
Expression Region: 28-127aa; Partial.
Tag information:N-terminal 10xHis-tagged.
Sequence:

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Target Data

Function	Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Gene References into Functions	Authors performed an analysis of public databases and literature for every variant published associated with FH, in the genes LDLR, APOB, and PCSK9. PMID: 29261184 Targeted next generation DNA sequencing revealed several rare heterozygous missense variants in both MTTP and APOB genes known or predicted to be deleterious, in addition to a novel heterozygous missense variant in SAR1B, which encodes the gene causing chylomicron retention disease PMID: 29540175 Single nucleotide polymorphisms rs693 and rs6725189 of the apoB gene are associated with calcific aortic stenosis in Chinese subjects, in Xinjiang, China. PMID: 29514644 In conclusion, this study demonstrated that an APOB SNP, rs1042034, is closely associated with HCV infection through lipid metabolism alteration. PMID: 29382324 APOB rs11279109 is associated with increased risk of coronary heart disease in Kuwaiti population. PMID: 29362515 The simultaneous retention of fibrinogen and APOB-lipoproteins in FSD can be detected in routinely stained histological sections. The analysis of protein structures unraveled the pathomorphogenesis of this unexpected phenomenon. Fibrinogen gamma chain mutations provoke conformational changes in the region of the globular domain involved in the "end-to-end" interaction, thus impairing the D-dimer formation PMID: 29244742 APOB polymorphism rs679899 is associated with type 2 diabetes and glutamyl transpeptidase levels, while the LIPC polymorphism rs6083 may influence plasma lipid levels in Chinese Han population. PMID: 29883758 We present a case of homozygous familial defective apolipoprotein B-100 due to APOB R3500Q (rs5742904) treated with evolocumab ..Identification of a patient homozygous for familial defective apolipoprotein B-100(FDB) and successful treatment with PCSK9 inhibition PMID: 28988723 Increased LDL levels were observed over time in patients with the -7673G>A polymorphism of the ApoB gene. PMID: 29846435 Review/Meta-analysis: significant association of APOB rs1801701 GA, and APOB rs1042031 GA with increased risk of ischemic stroke. PMID: 28865324 Serum apoB/A-I ratio appears to have value for predicting SAP in patients with AP. PMID: 28677336 Apolipoprotein B is associated with carotid atherosclerosis progression PMID: 28826575 Results show differences in the apoB100 secondary structure content among lipoproteins incubated at pH 7.4 or at pH 5.0 that could resemble those occurring in the early or late endosomes, respectively. PMID: 27824107 Elevated serum apoB levels independently predict an increased risk for incident non-alcoholic fatty liver disease. PMID: 28106941 This study shows that the ApoB-516C/T promoter gene polymorphism has no impact on the risk of hepatitis C virus infection. However, the C/T genotype may be a protective factor for females. PMID: 28370191 association of TM6SF2 rs58542926 genotype with increased serum tyrosine levels and decreased apoB-100 particles in Finns PMID: 28539357 that apos involved in TG metabolism such as apoC2, C3, E, and A4 (micromolar concentration), and apoB48 and apoA5 (single-digit nanomolar concentration) can be quantified from a single digestion mixture. PMID: 24694356 These findings indicate that maternal apo B levels are significantly associated with apo B levels in their pre-school age children, adjusted for confounding variables. Furthermore, the mother-child correlations in apo B levels were independent of mother-child adiposity. Measurement of apo B levels in mothers may identify both high-risk children and mothers who may benefit from intervention. PMID: 28799493 Individuals with apoB higher than predicted by non-HDL-C had significantly higher levels of PAI-1, which may contribute to the increased risk of future atherothrombotic events PMID: 28502501 analysis of five likely pathogenic heterozygous rare variants that include four novel nonsense mutations in APOB (p.Gln845, p.Gln2571, p.Cys2933* and p.Ser3718*) and a rare variant in PCSK9 (Minor Allele Frequency <0.1%). PMID: 27179706 In this sample of older adults with mild cognitive impairment, the presence of at least one copy of ApoE4 was associated with the development of both increased gait variability and cognitive decline during 1 year of follow-up PMID: 28482102 The impact of smoking on the levels of apolipoprotein B (APOB) was evaluated by analyzing data from NHANES for the years 2007-2012 for US adolescents aged 12-19 years and adults aged greater than or eqult to 20 years. The study found that smoking did not influence the observed levels of APOB for either adolescents or adults. PMID: 28672200 Identify LDLR, APOB and PCSK9 novel mutations causing familial hypercholesterolemia in the central south region of China. PMID: 28235710 Rare variants of APOB or PCSK9 were identified in nine of the 22 study patients with extremely low LDL-C levels PMID: 29036232 Eicosapentaenoic acid has direct antioxidant benefits in various apoB-containing subfractions. PMID: 26945158 Association of plasma apoB with IR in obese subjects is dependent on gynoid WAT dysfunction PMID: 28391908 Serum ApoB was not significantly different between term SGA newborns and control term newborns. PMID: 28304324 APOB associated with Familial Hypercholesterolemia and Polygenic Hypercholesterolemia in patients with Acute Coronary Syndrome , age /=160 mg/dl. PMID: 28958330 we identified common intronic SNPs (rs676210 and rs1042034) in the APOB gene and found five SNPs that were collectively associated with hyperlipidemia in the adult Chinese Yugur population. Importantly, we demonstrated that the G allele of rs676210 may confer an increased risk of hyperlipidemia. PMID: 28902930 APOB missense variants, A224T and V925L, in a black South African woman with marked hypocholesterolemia PMID: 27206948 male gender, ageing in women and menopause were associated with increased apoB concentrations. PMID: 27086565 Data provide no evidence supporting an association between the APOB R3527Q variant and type 2 diabetes or glycemia. PMID: 28428224 Levels of lipoprotein (a) [Lp(a)], a complex between an LDL-like lipid moiety containing one copy of apoB, and apo(a), a plasminogen-derived carbohydrate-rich hydrophilic protein, are primarily genetically rIncreasing evidence suggests that age, sex, and hormonal impact may have a modest modulatory influence on Lp(a) levels. Among clinical conditions, Lp(a) levels are reported to be affected by kidney and liver diseases. PMID: 26637279 Data suggest that amphipathic beta-strands in 200 N-terminal residues of beta1 domain of APOB are required for secretion of lipid-rich or lipid-poor particles; residues 300-700 or 1050-1500 of beta1 domain appear to be required for secretion of lipid-rich particles; MTTP is required for secretion of intact APOB but not of truncated APOB. (APOB = apolipoprotein B; MTTP = microsomal triglyceride transfer protein) PMID: 28702990 Basal apoB secretion by BeWo cells supports the concept of basal lipoprotein particle secretion by placental syncytiotrophoblast. PMID: 28487135 ApoB EcoRI confers a moderate risk for coronary heart disease and the E(-) allele at this locus might be a susceptibility allele for the development of disease (Meta-Analysis) PMID: 27637205 APOB single nucleotide polymorphism and it's association with LDL cholesterol level and risk of coronary heart disease in Pakistani population PMID: 27112212 High apoB48 concentration is associated with Atherosclerotic Lesion Progression. PMID: 27487947 Autoantibodies to oxidized lipoproteins and immune complexes with apoB-100 lipoproteins vary significantly by sex, age, and ethnicity. Higher baseline IgG MDA-LDL titers independently associate with new major adverse cardiovascular events. PMID: 28473443 miR-548p regulates apoB secretion by targeting its mRNA degradation. PMID: 28336556 Adolescent girls with obesity and polycystic ovary syndrome have elevated fasting and postprandial plasma triglycerides and ApoB-lipoprotein remnants. PMID: 27997268 the associations of rs693 and rs562338 polymorphisms representing the Apolipoprotein B locus with endophenotypes (total cholesterol [TC] and high-density lipoprotein cholesterol) and phenotypes, were examined. PMID: 27683205 ApoB100 is indispensable for HCV infection. ApoB is required for the generation of fully infectious HCV virions. PMID: 28018102 a higher inflammatory status is associated with decreased triglyceride-rich-rich lipoprotein apoB-48 secretion among insulin resistant subjects PMID: 28183448 Several protein markers were also deregulated in extracellular vesicless from bladder tumour patients, and our data suggest that the presence of ApoB in the 100,000 pellet is a clear marker for malignancy. PMID: 27751843 10 association studies for Han Chinese, with 1195 CHD patients and 1178 healthy subjects, we found that XbaI (rs693) polymorphisms in APOB were statistically significantly associated with Coronary Heart Disease in Han Chinese population PMID: 27172140 We observed a significant interaction between Ins/Del ApoB genotype and dietary omega-3 PUFA intake with respect to BMI, WC, and obesity risk in both unadjusted (P = 0.007, P = 0.001, and P = 0.021, respectively) and adjusted (P = 0.007, P = 0.04, and P = 0.002, respectively) samples in NIDDM patients. PMID: 27210509 Multiple novel LDLR and ApoB mutations have been identified in a-United Kingdom-based cohort with familial hypercholesterolemia. PMID: 26748104 Data suggest that LDL-C/apoB ratio (ratio of plasma level of total cholesterol to plasma level of apolipoprotein B) is an important biomarker in overall evaluation of atherogenicity in obese, overweight, and normal-weight men; this study of qualitative changes in lipid/lipoprotein profile for early diagnosis of dyslipidemias leading to atherosclerosis was conducted in Russia. PMID: 27347637 Mutations in APOB is associated with hypobetalipoproteinemia. PMID: 26916057 Show More Hide All
Involvement in disease	Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Subcellular Location	Cytoplasm, Secreted
Database Links	HGNC: 603 OMIM: 107730 KEGG: hsa:338 STRING: 9606.ENSP00000233242 UniGene: Hs.120759

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Human Apolipoprotein B-100(APOB),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Data

CloseMessage

×CloseMessage

Code	CSB-EP001918HUb0
Size	US$1726
Have Questions?	Leave a Message or Start an on-line Chat