Recombinant Human Apolipoprotein B-100(APOB),partial

In Stock
Code CSB-EP001918HUb0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P04114
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names APOB
Expression Region 28-127aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 14.7 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Involvement in disease Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Subcellular Location Cytoplasm, Secreted
Database Links

HGNC: 603

OMIM: 107730

KEGG: hsa:338

STRING: 9606.ENSP00000233242

UniGene: Hs.120759

Pathway Cholesterol metabolism

Q&A and Customer Reviews

Q&A
Q:

I'm looking for the full-length human recombinant ApoB-48 protein?

A:
Thanks for your inquiry.
Reference: https://www.uniprot.org/uniprot/P04114
The full-length human recombinant ApoB-48 protein refers to the region of 28-2179aa, the length is 2152aa, which is too difficult to express, sorry, we can't provide.Do you accept the partial protein ? If yes, please tell us the fragment of interest, we will check if we can provide.
Q:

Thank you for your response, I'm wondering what the maximum length of the ApoB-48 protein you can produce? I'm looking for a protein that is as complete as possible.

A:
Thanks for your inquiry.
Generally, The longer the length, the more difficult it is to express. The length is 2152aa, I'm afraid the full length protein is impossible to express.
For the time being, we can offer risk-free custom service for expressing protein within 800aa,and we can try to express longer protein within 1200aa,
but the custom service for protein expression with length over 800aa is charged step by step.
1.Protein length within 800aa: Risk-free custom service
2.Protein length over 800aa but less than 1200aa: Custom service charged step by step.
3.Protein length over 1200aa: We would rather not to try, but if the customer insists, we can try to express, it's charged step by step.
In addition, could you pls tell us your application of this protein ? Do it must be the purified protein, is the lysate be OK ?
If the lysate is OK, the success rate would be much higher.
BTW, we need to choose the suitable expression region according to your application, or if you could tell us the region, that would be better.
We can try any region with the length less than 1200aa.
Previously, we have successfully developed a partial protein listed as below:
Recombinant Human Apolipoprotein B-100(APOB),partial
CSB-EP001918HUb0 >> E.coli
Expression Region: 28-127aa; Partial.
Tag information:N-terminal 10xHis-tagged.
Sequence:

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Customer Reviews

Related Products

APOB Antibodies

APOB Antibodies for Homo sapiens (Human)

APOB Proteins

APOB Proteins for Homo sapiens (Human)

APOB ELISA Kit

APOB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.