Recombinant Human Apolipoprotein C-IV(APOC4)

Code CSB-YP001934HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P55056
Relevance May participate in lipoprotein metabolism.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Apolipoprotein C4
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Research Area Transport
Source Yeast
Gene Names APOC4
Protein Names Recommended name: Apolipoprotein C-IV Short name= Apo-CIV Short name= ApoC-IV Alternative name(s): Apolipoprotein C4
Expression Region 27-127aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May participate in lipoprotein metabolism.
Subcellular Location Secreted
Protein Families Apolipoprotein C4 family
Tissue Specificity Expressed by the liver and secreted in plasma.
Database Links

HGNC: 611

OMIM: 600745

KEGG: hsa:346

STRING: 9606.ENSP00000468236

UniGene: Hs.731599

Related Products

APOC4 Antibodies

APOC4 Antibodies for Homo sapiens (Human)

APOC4 Proteins

APOC4 Proteins for Homo sapiens (Human)

APOC4 ELISA Kit

APOC4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.