Recombinant Human Apolipoprotein M(APOM)

In Stock
Code CSB-EP001947HU1
Abbreviation Recombinant Human APOM protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Protein G3a
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
18-188aa
Target Protein Sequence
NSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
Gene References into Functions
  1. Obese patients showed significantly lower plasmatic ApoM levels than people with normal body weight, and ApoM level showed a strong correlation with CRP, TNF-alpha, and IL-6 levels, which indicated that ApoM might be regulated by these inflammatory factors. PMID: 30110274
  2. These results demonstrated that ApoM protein mass were clearly higher in the NSCLC tissues than in non-small cell lung cancer (NSCLC) tissues. Overexpression of ApoM could promote NSCLC cell proliferation and invasion in vitro and tumor growth in vivo, which might be via upregulating S1PR1 and activating the ERK1/2 and PI3K/AKT signaling pathways. PMID: 29750961
  3. results do not suggest a diagnostic role for ApoM plasma levels in patients with primary VTE. Moreover, the current study suggests that role of ApoM as a risk factor may differ for primary VTE and recurrent VTE in male patients. PMID: 28914078
  4. These S1P-induced enhancements in growth factors and chemotactic cytokines in retinal pigment epithelium cells were significantly inhibited by ApoM treatment. Additionally, in vivo experiments using a laser-induced choroidal neovascularization (CNV) murine model demonstrated that intravitreal ApoM injection significantly reduced the progression of CNV formation. PMID: 29301231
  5. The potential of mean force for sphingosine-1-phosphate unbinding from apoM reflected a large binding strength of more than 60 kJ/mol. This high unbinding free energy for sphingosine-1-phosphate underlines the observed specificity of the physiological effects of sphingosine-1-phosphate as it suggests that the spontaneous release of sphingosine-1-phosphate from apoM is unlikely. PMID: 27476912
  6. results demonstrated that lower APOM levels in SLE patients and correlated with disease activity. PMID: 28476116
  7. Sequenced the ApoM gene in recurrent venous thromboembolism (VTE) and identified six polymorphisms. ApoM rs805297 was significantly associated with higher risk of VTE recurrence in male but not in female patients. PMID: 27277397
  8. Single nucleotide polymorphism in ApoM gene is associated with chronic obstructive pulmonary disease. PMID: 28927745
  9. ApoM T-855C and T-778C polymorphisms were found to be associated with obesity by regulating HDL metabolism, and the T alleles of apoM T-778C were shown to be more strongly correlated. PMID: 28245483
  10. liver mRNA levels of apoM and apoA1 decreased strongly upon sepsis induction. PMID: 26990127
  11. 17beta-estradiol induced up-regulation of apoM in HepG2 cells is through an ER-alpha-dependent pathway involving ER-alpha binding element in the promoter of the apoM gene. PMID: 28359281
  12. A shift in ApoM/sphingosine 1-phosphate between HDL-particles in women with type 1 diabetes mellitus Is associated with impaired anti-inflammatory effects of the ApoM/S1P complex. PMID: 28385702
  13. ApoM-bound sphingosine-1-phosphate regulates adhesion molecule abundance, leukocyte-endothelial adhesion, and endothelial barrier function via sphingosine-1-phosphate receptor1. PMID: 27879252
  14. HDL-associated ApoM is anti-apoptotic by delivering sphingosine 1-phosphate to S1P1 and S1P3 receptors on vascular endothelium. PMID: 28179022
  15. Plasma apoM concentrations are higher in patients with hyperlipidaemia than in healthy controls. Low plasma apoM levels in patients with T2DM are likely caused by diabetes but are not induced by hyperlipidaemia. PMID: 27633510
  16. The polymorphism C-724del in the promoter region of the apoM gene could confer the risk of T2DM among eastern Han Chinese. Unfortunately, the lowing of plasma apoM levels of C-724del mutant allele carriers compared with the wide-type homozygotes carriers in T2DM patients was not statistically different in present study, so further researchs were needed by enlarging the sample PMID: 27576735
  17. ApoM rs805296 polymorphism may be a risk factor for developing coronary artery disease [meta-analysis] PMID: 26723879
  18. ApoM/HDL-C and apoM/apoA1 ratios could be used as indicators for identification of DN from healthy people and from T2DM patients. PMID: 28073663
  19. ApoM may be a biomarker of coronary artery disease. ApoM-855 T-->C substitution provides binding sites for AP-2alpha and reduces ApoM transcription activity PMID: 27841911
  20. Data indicate significant association between the single nucleotide polymorphism (SNP rs805296) of apolipoprotein M (ApoM) and the susceptibility to ankylosing spondylitis (AS) among Chinese Han population in Lanzhou. PMID: 27412944
  21. Serum apolipoprotein M was elevated in chronic obstructive pulmonary disease patients and increased gradually with chronic obstructive pulmonary disease severity. PMID: 27001252
  22. ApoM is excreted in the urine of children after cardiac surgery in children with acute kidney injury PMID: 26642098
  23. Hyperglycemia-induced downregulation of apolipoprotein M expression is not via the hexosamine pathway. PMID: 26377577
  24. ApoM is highly expressed in renal proximal tubule cells and is usually reabsorbed by giantin-associated proteins in a process, which is also affected in kidney disease. PMID: 25901639
  25. our findings present supportive evidence that ApoM is a regulator of human LRH-1 transcription, and further reveal the importance of ApoM as a critical regulator of bile acids metabolism PMID: 25987835
  26. -724 I/D polymorphism decreases the apoM promoter activity, down-regulates the apoM protein expression level, and increases the risk of myocardial infarction PMID: 25637426
  27. these findings demonstrated that apoM suppressed TNF-alpha-induced expression of ICAM-1 and VCAM-1 through inhibiting the activity of NF-kappaB. PMID: 26057873
  28. role of apoM in lipid metabolism and cardiometabolic diseases.(48-55) PMID: 25551802
  29. ApoM levels differ according to country of birth and are associated with IR and T2DM only in native-born Swedes, not Iraqis living in Sweden. PMID: 24984825
  30. Binary logistic regression analysis suggested that both apoM and apoAI mRNA may considered as independent risk factors for fetal macrosomia PMID: 25194312
  31. ApoM overexpression may have a potential role in improving insulin resistance in vivo and modulating apoM expression might be a future therapeutic strategy against insulin resistance in type 2 diabetes. PMID: 25144649
  32. Single nucleotide polymorphism in APOM is associated with lung cancer. PMID: 25187487
  33. the apolipoprotein M/HDL pathway may have a role in the pathogenesis of COPD and emphysema [meta-analysis] PMID: 23900982
  34. Decreased activities of apolipoprotein m promoter are associated with the susceptibility to coronary artery diseases. PMID: 24578614
  35. the functional single-nucleotide polymorphism APOM rs805297 G/T variant allele was associated with rheumatoid arthritis risk PMID: 23660425
  36. The apolipoprotein M rs805297 SNP is not associated with an increased risk for developing coronary artery disease, although it does independently correlate with dyslipidemia in Han Chinese individuals. PMID: 24341666
  37. Apolipoprotein M T-778C polymorphism is associated with serum lipid levels and the risk of coronary artery disease in the Chinese population. (Meta-analysis) PMID: 24040766
  38. Data indicate that palmitic acid induced suppression of apolipoprotein M (APOM) expression is mediated via the peroxisome proliferator-activated receptor beta/delta (PPARbeta/delta) pathway. PMID: 24508264
  39. The unique apoM/S1P-enriched plasma HDL may serve to deliver S1P to extrahepatic tissues for atheroprotection and may have other as yet unidentified functions. PMID: 24318881
  40. Apolipoprotein M as a chaperone for sphingosine-1-phosphate. [Review] PMID: 23652568
  41. Livers are involved in S1P dynamism, and it was suggested that apoM, produced from livers, increases circulating plasma S1P by augmenting the S1P output from livers and modifies extracellular S1P metabolism. PMID: 23664237
  42. Vascular endothelial growth factor downregulates apolipoprotein M expression PMID: 22877565
  43. Data support that the APOM C-1065A polymorphism is associated with increased risk for developing rheumatoid arthritis and dyslipidaemia in RA patients. PMID: 23190940
  44. The APOM gene rs707921 and rs707922 single nucleotide polymorphisms are associated with some serum lipid parameters. PMID: 23086303
  45. These data suggest that the plasma clearance of apoM, despite apoM primarily being associated with HDL, is influenced by LDL receptor-mediated clearance of apoB-containing particles. PMID: 22826357
  46. The present study demonstrated that apoM expression could be elevated by ABCA1 via the RXR/LXR pathway and LRH1 does not involve in the regulation of apoM by the activation of ABCA1, although the direct regulative pathway(s) between ABCA1 and apoM gene is still unknown yet. PMID: 22516753
  47. ApoM can bind oxidized phospholipids, increasing the antioxidant effect of HDL. PMID: 22204862
  48. Report plasma levels of sphingosine-1-phosphate and apolipoprotein M in patients with monogenic disorders of HDL metabolism. PMID: 21944699
  49. Single Nucleotide Polymorphism at the promoter region of the APOM gene is associated with rheumatoid arthritis. PMID: 21844665
  50. Raised ApoM levels in hepatitis B virus (HBV) infection may in turn suppress HBV replication PMID: 21875437

Show More

Hide All

Subcellular Location
Secreted. Note=Present in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins (LDL).
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Plasma protein. Expressed in liver and kidney.
Database Links

HGNC: 13916

OMIM: 606907

KEGG: hsa:55937

STRING: 9606.ENSP00000365081

UniGene: Hs.534468

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*