Recombinant Human Artemin (ARTN)

Code CSB-EP002160HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ARTN
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
108-220aa
Target Protein Sequence
AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
47.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue.
Gene References into Functions
  1. Artemin could promote the proliferation and invasiveness of lung cancer cells in vitro and therefore could be a new potential target to combat lung cancer. PMID: 29575549
  2. The data suggest that ARTN and MMP-9 are involved in the occurrence, development, invasion and metastasis of EC, and play a synergistic role in the development of EC and lymphatic metastasis. PMID: 29254290
  3. AhR activation and ARTN expression were positively correlated in the epidermis of patients with atopic dermatitis. PMID: 27869817
  4. Report the activity, pharmacokinetics, conformational dynamics and biophysical properties of different glycoforms of ART. PMID: 26908049
  5. High ARTN increased xenograft tumor size and metastasis in hepatocellular carcinoma. PMID: 26675549
  6. Artemin expression promotes invasiveness and neurotrophic function of pancreatic adenocarcinoma cells in vivo and in vitro PMID: 25243385
  7. mRNA expression of Artemin (Artn) in the tongue mucosa of patients with burning mouth syndrome was significantly higher than that of control subjects. PMID: 26270588
  8. This is the first report of increased levels of a neurotrophic factor and of a glial cell line-derived neurotrophic factor family member in GAD patients. PMID: 24994477
  9. conclude that ARTN is one mediator of acquired resistance to trastuzumab in HER2-positive mammary carcinoma cells PMID: 24737320
  10. The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma. PMID: 23351331
  11. ARTEMIN promotes de novo angiogenesis in ER negative mammary carcinoma through activation of TWIST1-VEGF-A signaling. PMID: 23185544
  12. ARTN promotion of the cancer stem cell-like cell phenotype was mediated by TWIST1 regulation of BCL-2 expression. PMID: 23095743
  13. High artemin promotes motility and invasiveness of pancreatic cancer. PMID: 22901124
  14. artemin lowers the threshold of temperature-dependent itch sensation. PMID: 22770266
  15. ARTN and TWIST1 synergize to produce a worse outcome in ER-MC and combined inhibition of ARTN and phosphatidylinositol 3-kinase/protein kinase B (PI3K/AKT) may therefore provide a novel therapeutic strategy in this subtype of mammary carcinoma. PMID: 22060274
  16. Presenting an efficient method for the recombinant bacterial production of large quantities of highly pure, biologically active ARTN for in vitro and in vivo studies. PMID: 21907286
  17. Studies indicate that artemin was highly expressed in squamous cell carcinoma lung cancer. PMID: 22008109
  18. These results reveal that ARTN, a known tumor metastasis-related gene, is a direct target of miR-223. PMID: 21453483
  19. Forced expression of ARTN in ER-positive human mammary carcinoma cells increased ER transcriptional activity, promoted estrogen-independent growth and produced resistance to tamoxifen. PMID: 20305694
  20. ARTN increased BCL2 expression by transcriptional upregulation, and inhibition of BCL2 abrogated the oncogenic properties of ARTN in non-small cell lung carcinoma cells. PMID: 20530713
  21. Artemin is a key player in the generation of pancreatic neuropathy in pancreatic neoplasms. PMID: 20395845
  22. Artemin and GFRalpha3 expressions may play an important role in perineural invasion of pancreatic carcinoma. PMID: 19304517
  23. expression in endometrial carcinoma significantly associated with higher tumor grade and invasiveness PMID: 20118197
  24. The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons. PMID: 15829225
  25. This study suggests that ART binds heparan sulfate proteoglycans (HSPG) and identifies residues that may be involved in HSPG binding. PMID: 16734417
  26. 1.92 A crystal structure of the complex formed between ARTN and its receptor GFRalpha3 was reported. PMID: 16765900
  27. Data show that reduced expression levels of ARTN mRNAs are found in patients with major depressive disorder in a current depressive state, but not in a remissive state. PMID: 18313696
  28. No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients. PMID: 18970938
  29. Forced expression of artemin in mammary carcinoma cells results in increased anchorage-independent growth, increased colony formation in soft agar and in Matrigel, and promotes a scattered cell phenotype with enhanced migration and invasion. PMID: 19363524

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family, GDNF subfamily
Tissue Specificity
Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain.
Database Links

HGNC: 727

OMIM: 603886

KEGG: hsa:9048

STRING: 9606.ENSP00000387435

UniGene: Hs.632404

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*