Recombinant Human Bis (5'-nucleosyl)-tetraphosphatase [asymmetrical] (NUDT2)

Code CSB-EP2105HU
Abbreviation Recombinant Human NUDT2 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NUDT2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
2310051L06Rik; 5''''-P1; AA939917; Ap4A hydrolase 1; Ap4A hydrolase; AP4A_HUMAN; Ap4Aase; APAH 1; APAH1; Bis(5' nucleosyl) tetraphosphatase [asymmetrical]; Bis(5''-nucleosyl)-tetraphosphatase [asymmetrical]; Diadenosine 5''; Diadenosine 5',5''' P1,P4 tetraphosphate asymmetrical hydrolase; Diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase; Diadenosine tetraphosphatase; EC 3.6.1.17; MGC10404; Nucleoside diphosphate linked moiety X motif 2; Nucleoside diphosphate-linked moiety X motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; Nudix motif 2; Nudix-type motif 2; NUDT 2; NUDT2; OTTHUMP00000021256; OTTHUMP00000021257; OTTHUMP00000021258; OTTHUMP00000021259; P4-tetraphosphate asymmetrical hydrolase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-147aa
Target Protein Sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) to yield AMP and ATP. Exhibits decapping activity towards FAD-capped RNAs and dpCoA-capped RNAs in vitro.
Gene References into Functions
  1. NUDT2 is a novel complex formation enhancing factor regulating mTORC1-Rag GTPase signaling that is crucial for cell growth control. PMID: 28089905
  2. Regulation of gene expression is one of several roles proposed for the stress-induced nucleotide diadenosine tetraphosphate (Ap4A). We have examined this directly by a comparative RNA-Seq analysis of KBM-7 chronic myelogenous leukemia cells and KBM-7 cells in which the NUDT2 Ap4A hydrolase gene had been disrupted (NuKO cells), causing a 175-fold increase in intracellular Ap4A. PMID: 27144453
  3. This paper presents the crystal structure of wild-type and E58A mutant human Ap4A hydrolase. PMID: 23384440
  4. High NUDT2 is associated with breast carcinoma. PMID: 20533549
  5. In this study the authors present data demonstrating that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17). PMID: 20144233
  6. crystallographic structure and substrate-binding mechanism of Ap4A hydrolase PMID: 15596429
  7. NMR resonance assignments PMID: 15772762

Show More

Hide All

Protein Families
Nudix hydrolase family
Database Links

HGNC: 8049

OMIM: 602852

KEGG: hsa:318

STRING: 9606.ENSP00000338397

UniGene: Hs.493767

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*