Recombinant Human Bone marrow proteoglycan (PRG2), partial

In Stock
Code CSB-EP018670HU1
Abbreviation Recombinant Human PRG2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PRG2
Uniprot No.
Research Area
Immunology
Alternative Names
PRG2; MBP; Bone marrow proteoglycan; BMPG; Proteoglycan 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
17-104aa
Target Protein Sequence
LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Enhance your immunological research with our high-quality Recombinant Human PRG2 protein, a crucial component of the bone marrow microenvironment. Bone marrow proteoglycan, also known as BMPG or Proteoglycan 2, plays a significant role in regulating cellular adhesion and growth in the bone marrow niche. Its involvement in these processes makes it an important target for researchers investigating the complex mechanisms underlying immune cell development and homeostasis.

Our Recombinant Human PRG2 protein is expressed in E. coli, ensuring a robust and reliable product for your research needs. Covering a partial region of the protein from 17-104aa, our recombinant PRG2 retains key functional domains essential for your experiments. To streamline protein purification and detection, the N-terminal 6xHis-GST tag has been added to our recombinant protein. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Human PRG2 protein is provided as a lyophilized powder, offering you a consistent and trustworthy tool for your immunology research projects.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Gene References into Functions
  1. Low PRG2 expression is associated with drug resistance in Chronic myeloid leukemia. PMID: 29936783
  2. MBP-1 aggregation is important for innate immunity and immunopathology mediated by eosinophils.MBP-1 toxicity is restrained via crystallization in eosinophil secretory granules. PMID: 25728769
  3. free protein in nasal mucus can be used as a biomarker to diagnose chronic rhinosinusitis PMID: 25266917
  4. mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation. PMID: 24814827
  5. This protein contains a peptide that displays strong antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi. PMID: 319906
  6. Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-beta1. PMID: 24112102
  7. During pregnancy, the proform of eosinophil major basic protein-angiotensinogen constitutes the major form in late pregnancy. PMID: 23033876
  8. Combinations of respiratory syncytial virus and MBP synergistically induced cell death in pulmonary alveolar epithelial cells (A549). PMID: 20977431
  9. The expression of MBP in nasal mucus obtained from chronic rhinosinusitispatients was obviously higher than that of nasal mucus obtained from controls. PMID: 18720885
  10. MBP and NE collaborated to cause the pathological effects of nasal polyps. PMID: 18476621
  11. novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production PMID: 20849415
  12. The proMBP is a novel first trimester serum marker for adverse pregnancy outcome. PMID: 19626619
  13. Transcription is regulated by novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms. PMID: 12202480
  14. IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which in turn is regulated by proMBP PMID: 12370176
  15. MBP's structure is described, and its ability to bind to pregnancy-associated plasma protein A explained PMID: 12421832
  16. Deposits of eosinophilic MBP are found on the surface of eosinophils and damaged muscle fibers surrounded by eosinophils in patients with idiopathic eosinophilic myositis. PMID: 12534990
  17. MBP stimulates a Src kinase-dependent activation of class I(A) phosphoinositide 3-kinase and, in turn, activation of protein kinase C zeta in neutrophils, which contributes to the activation of NADPH oxidase and resultant superoxide production. PMID: 14500673
  18. Proform of MPB forms a covalent complex with PAPPA in which PAPPA is inhibited. PMID: 14988014
  19. the proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A PMID: 15647258
  20. two regions shown previously to contain the cytotoxic and cytostimulatory properties of MBP are accessible for ligand interaction in cell surface-bound MBP PMID: 16940047
  21. Compared to MBP1, which is present in eosinophils, basophils, and a human mast cell line, homologous MBP2 is present only in eosinophils and may be a useful biomarker for eosinophil-associated diseases. PMID: 17082653
  22. Pregnancy-associated plasma protein A is involved in processes preceding vulnerable plaque development in acute coronary syndrome. PMID: 17223728
  23. knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through p53-p21 pathway. PMID: 18852884
  24. No variation in genes major basic protein for Atopic dermatitis pathogenesis in this German cohort PMID: 19014520
  25. The significantly elevated levels of proMBP in myelofibrosis patients implies that proMBP could be an important stromal cytokine in bone marrow fibrosis. PMID: 19039208
  26. addition to granule-stored MBP, even unstimulated eosinophils contained appreciable amounts of MBP within secretory vesicles PMID: 19398958

Show More

Hide All

Subcellular Location
[Bone marrow proteoglycan]: Secreted. Note=The proform is secreted.; [Eosinophil granule major basic protein]: Cytoplasmic vesicle, secretory vesicle. Note=The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core).
Tissue Specificity
High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and co
Database Links

HGNC: 9362

OMIM: 605601

KEGG: hsa:5553

STRING: 9606.ENSP00000312134

UniGene: Hs.512633

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*