Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PRG2

Uniprot No.

P13727

Research Area

Immunology

Alternative Names

PRG2; MBP; Bone marrow proteoglycan; BMPG; Proteoglycan 2

Species

Homo sapiens(Human)

Source

in vitro E.coli expression system

Expression Region

106-222aa

Target Protein Sequence

TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.8kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the exciting capabilities of our Recombinant Human PRG2, a central player in human immunology research. This product represents the Bone marrow proteoglycan (BMPG), also known as Proteoglycan 2, encoded by the PRG2 gene in humans. BMPG plays an essential role in immune response, making it a pivotal protein in the field of immunology.

This recombinant BMPG is derived from an in vitro E.coli expression system and spans a partial sequence, specifically covering the amino acid region from 106 to 222. It comes with an N-terminal 6xHis-SUMO tag, facilitating ease of purification and detection. This Recombinant Human PRG2 reaches a purity greater than 90%, as verified by SDS-PAGE, providing you with a high-quality product for reliable experimental results. Available in both liquid and lyophilized powder form, it is designed to suit your laboratory needs. With this product, you can delve into deeper understanding and possibly contribute to the advancement of immunology research.

Target Background

Function

Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.

Gene References into Functions

Low PRG2 expression is associated with drug resistance in Chronic myeloid leukemia. PMID: 29936783
MBP-1 aggregation is important for innate immunity and immunopathology mediated by eosinophils.MBP-1 toxicity is restrained via crystallization in eosinophil secretory granules. PMID: 25728769
free protein in nasal mucus can be used as a biomarker to diagnose chronic rhinosinusitis PMID: 25266917
mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation. PMID: 24814827
This protein contains a peptide that displays strong antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi. PMID: 319906
Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-beta1. PMID: 24112102
During pregnancy, the proform of eosinophil major basic protein-angiotensinogen constitutes the major form in late pregnancy. PMID: 23033876
Combinations of respiratory syncytial virus and MBP synergistically induced cell death in pulmonary alveolar epithelial cells (A549). PMID: 20977431
The expression of MBP in nasal mucus obtained from chronic rhinosinusitispatients was obviously higher than that of nasal mucus obtained from controls. PMID: 18720885
MBP and NE collaborated to cause the pathological effects of nasal polyps. PMID: 18476621
novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production PMID: 20849415
The proMBP is a novel first trimester serum marker for adverse pregnancy outcome. PMID: 19626619
Transcription is regulated by novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms. PMID: 12202480
IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which in turn is regulated by proMBP PMID: 12370176
MBP's structure is described, and its ability to bind to pregnancy-associated plasma protein A explained PMID: 12421832
Deposits of eosinophilic MBP are found on the surface of eosinophils and damaged muscle fibers surrounded by eosinophils in patients with idiopathic eosinophilic myositis. PMID: 12534990
MBP stimulates a Src kinase-dependent activation of class I(A) phosphoinositide 3-kinase and, in turn, activation of protein kinase C zeta in neutrophils, which contributes to the activation of NADPH oxidase and resultant superoxide production. PMID: 14500673
Proform of MPB forms a covalent complex with PAPPA in which PAPPA is inhibited. PMID: 14988014
the proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A PMID: 15647258
two regions shown previously to contain the cytotoxic and cytostimulatory properties of MBP are accessible for ligand interaction in cell surface-bound MBP PMID: 16940047
Compared to MBP1, which is present in eosinophils, basophils, and a human mast cell line, homologous MBP2 is present only in eosinophils and may be a useful biomarker for eosinophil-associated diseases. PMID: 17082653
Pregnancy-associated plasma protein A is involved in processes preceding vulnerable plaque development in acute coronary syndrome. PMID: 17223728
knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through p53-p21 pathway. PMID: 18852884
No variation in genes major basic protein for Atopic dermatitis pathogenesis in this German cohort PMID: 19014520
The significantly elevated levels of proMBP in myelofibrosis patients implies that proMBP could be an important stromal cytokine in bone marrow fibrosis. PMID: 19039208
addition to granule-stored MBP, even unstimulated eosinophils contained appreciable amounts of MBP within secretory vesicles PMID: 19398958

Hide All

Subcellular Location

[Bone marrow proteoglycan]: Secreted. Note=The proform is secreted.; [Eosinophil granule major basic protein]: Cytoplasmic vesicle, secretory vesicle. Note=The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core).

Tissue Specificity

High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and co

Database Links

HGNC: 9362

OMIM: 605601

KEGG: hsa:5553

STRING: 9606.ENSP00000312134

UniGene: Hs.512633

Code	CSB-CF018670HUa2
Abbreviation	Recombinant Human PRG2 protein
MSDS	MSDS Datasheet
Size	$878
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Bone marrow proteoglycan (PRG2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage