Recombinant Human Bone morphogenetic protein 15 (BMP15)

In Stock
Code CSB-EP002735HU
Abbreviation Recombinant Human BMP15 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BMP15
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Growth/differentiation factor 9B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
268-392aa
Target Protein Sequence
QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The pipeline for the recombinant Human BMP15 protein production in e.coli cells consists of the following consecutive steps: construction of the expression vector encoding the Human BMP15 protein (268-392aa), its transformation into e.coli cells, high-density cultivation and induction of the positive cells, cell lysis, and expression analysis. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The resulting recombinant Human BMP15 protein is purified from the cell lysate through affinity purification, and its purity is greater than 90% determined by the SDS-PAGE.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
Gene References into Functions
  1. The present mini-review provides an overview of recent findings relating GDF-9 and BMP-15 as fundamental factors implicated in the regulation of ovarian function and discusses their potential role as markers of oocyte quality in women. PMID: 30039232
  2. Data suggest that GDF9 and BMP15 are oocyte-secreted factors with leading roles in control of ovarian function in female reproduction, modulating both fate of somatic granulosa cells and quality/developmental competence of the egg. (GDF9 = growth and differentiation factor-9; BMP15 = bone morphogenetic protein-15) [REVIEW] PMID: 29544636
  3. the expression of BMP15 in follicular fluid and Smad1 in granulosa cells was significantly decreased in the PCOS group compared with the control (P<0.05). The data suggested that the BMP15/Smad1 signalling pathway may be involved in granulosa cell apoptosis PMID: 28983616
  4. BMP15 did not seem critical for follicles to enter the growth phase. Genetic counselling should be performed and fertility preservation discussed before progressive loss of follicular reserve PMID: 28094433
  5. Mutations in BMP15 associated with primary ovarian insufficiency reduce mature protein production, activity, or synergy with GDF9. PMID: 28359091
  6. Human GDF9 and BMP15 act synergistically to stimulate granulosa cell proliferation, a response that also involves species-specific non-SMAD signalling pathways. PMID: 25155366
  7. GDF9 c.169G>T (D57Y), c.546G>A (rs1049127), and BMP15 rs79377927 (788_789insTCT) were associated with premature ovarian failure in the Chinese Hui population. PMID: 25954833
  8. BMP15 supplementation differentially modulates reductive metabolism and mitochondrial localization within the oocyte. PMID: 25721374
  9. results support a model of activation for human GDF9 dependent on cumulin formation through heterodimerization with BMP15. Oocyte-secreted cumulin is likely to be a central regulator of fertility in mono-ovular mammals. PMID: 26254468
  10. GDF9 and BMP15 expression is reduced in primordial, primary, and secondary follicles in ovarian tissues of PCOS patients. PMID: 25172094
  11. The results showed no direct association between BMP15-9G or 852T and the development of premature ovarian failure (POF). Women with the 538A mutation are up to five times more likely to develop POF. The 788insTCT polymorphism had low biological impact. PMID: 25445105
  12. the BMP15 c.-9G allele is related to BMP15 increased transcription, supporting c.-9C>G as a causal agent of premature ovarian failure PMID: 25246117
  13. BMP15 polymorphism is not associated with ovarian reserve. PMID: 25336710
  14. BMP15 is a critical regulator of folliculogenesis and granulosa cell activities. Variations in BMP15 gene dosage have a relevant influence on ovarian function and can account for several defects of female fertility. PMID: 24980253
  15. Data suggest upregulation of mRNA for BMP15 and GDF9 (growth differentiation factor 9) in cumulus granulosa cells serves as biomarker for oocyte maturation, fertilization, embryo quality, and pregnancy in couples undergoing ICSI for male infertility. PMID: 25139161
  16. Oocyte-derived BMP15 decreases gap junction intercellular communication activity between human granulosa cells by down-regulating Cx43 expression, most likely via a Smad-dependent signaling pathway. PMID: 24413384
  17. BMP15 down-regulates StAR expression and decreases progesterone production in human granulosa cells, likely via ALK3-mediated SMAD1/5/8 signaling. PMID: 24140593
  18. Data from cultured mouse preantral follicles suggest that [human recombinant] BMP15 promotes follicle growth in short term (24 hours) incubation; subsequently BMP15 (48-72 hours) causes follicular atresia with increased granulosa cell apoptosis. PMID: 23782946
  19. genetic association studies in population of women in Spain: Data suggest an association between an SNP in BMP15 (rs3897937) and age at menopause; thus, duration of fertility in women may have genetic determinants involved in estrogen metabolism. PMID: 23173577
  20. BMP15 and GDF9 transcript levels increase in mature oocytes from women with polycystic ovary syndrome after ovarian stimulation, and might inhibit the progesterone secretion by follicular cells PMID: 22825968
  21. the activation of bone morphogenetic protein 15 gene (BMP15) during the differentiation of human amniotic fluid stem cells (hAFSCs) into oocyte-like cells PMID: 22356426
  22. This study evaluated the levels of bone morphogenetic protein receptors BMPRIB and BMPRII mRNA in goat follicles and the effects of bone morphogenetic protein-15 (BMP-15) on the in vitro development of cultured preantral follicles. PMID: 22382392
  23. BMP15 uses preferentially BMPR1B as its type I receptor, suggesting an important role for the BMPR1B receptor in human female fertility PMID: 22294741
  24. BMP15 is associated with high response to ovarian stimulation. PMID: 21565556
  25. BMP15 gene mutations may be potentially associated with polycystic ovarian syndrome patients. PMID: 22014425
  26. In the samples from girls/women, the number of developing follicles was greater with GDF9 or BMP15 alone than with no BMP15 or GDF9. PMID: 21632818
  27. The expression of GDF9 and BMP15 in oocytes from patients with polycystic ovary syndrome cannot reach the normal level even after ovarian stimulation. PMID: 21669410
  28. There were no statistically significant differences in embryo quality among the patients regarding follicular fluid BMP15 expression status. PMID: 21496799
  29. Results describe a purified untagged human BMP15 mature region, which is stable and highly bioactive in human and rodent granulosa cells and as such is of importance for studies on human fertility. PMID: 20937357
  30. Integral role of GDF-9 and BMP-15 in ovarian function. PMID: 21226076
  31. Impaired production of BMP15 and GDF9 mature proteins derived from proproteins with mutation in the proregion. PMID: 20547206
  32. Various missense variants of the BMP15 gene were identified among patients with premature ovarian failure. PMID: 20364024
  33. data demonstrate that polymorphisms in major folliculogenesis genes, GDF9, BMP15, AMH, and AMHR2, are not associated with polycystic ovary syndrome susceptibility. PMID: 20236105
  34. No significant difference was detected in the expression of BMP-15 between patients with polycystic ovary syndrome and controls. PMID: 19376510
  35. Data show that show that Golgi apparatus casein kinase (G-CK) catalyzes the phosphorylation of rhBMP-15 and rhGDF-9. PMID: 20067794
  36. in Chinese premature ovarian failure patients, study revealed 3 variants in coding region of BMP15 - an insertion p.262insLeu in 5 patients & 2 novel mutations c.985C>T (p.Arg329Cys)& c.598C>T (p.His200Tyr) PMID: 19438907
  37. Results describe the expression and characterization of recombinant human BMP15, which is biologically active and very stable, and can induce the expression of a variety of mouse granulosa cell genes. PMID: 19651638
  38. Bone morphogenetic protein-15 is expressed in oocytes and cumulus granulosa cells and may play an important role in the hCG-induced oocyte final maturation and corpus luteum (CL) formation PMID: 19635612
  39. Data show that bone morphogenetic protein-15 activates the Smad pathway in granulosa cell models. PMID: 12419820
  40. interaction with growth and differentiation factor-9 and implication in aberrant ovarian phenotype PMID: 12446716
  41. BMP-15 and GDF-9 have roles in fertility; critical sequences are determined by mutagenesis PMID: 14970198
  42. Hypergonadotropic ovarian failure is associated with an inherited mutation of human bone morphogenetic protein-15 gene. PMID: 15136966
  43. comparison of the molecular characteristics of BMP-15 of polyovulatory mice with that of monoovulatory humans PMID: 15809424
  44. Missense mutations in the BMP15 gene are associated with ovarian failure PMID: 16508750
  45. although mutations in BMP15 and GDF9 are not a major cause of ovarian insufficiency, they may be involved in premature ovarian failure PMID: 16645022
  46. Mutational screening of the bone morphogenetic protein 15 (BMP15) and growth differentiation factor 9 (GDF9) genes in a population with premature ovarian failure (POF) identified no new mutations. PMID: 17027369
  47. a BMP15 alteration,as a possible cause of ovarian failure, previously described as a mutation, is instead a polymorphism PMID: 17826728
  48. We analyzed two polymorphisms (-9C>G and IVS1+905A>G) within the BMP15 gene in women from Spain with polycystic ovary syndrome (PCOS). BMP15 gene does not seem to be associated with PCOS. PMID: 17905236
  49. phosphorylation state of rhBMP-15 and rhGDF-9 is a determinant of their agonistic and antagonistic activities PMID: 18006624
  50. characterization of the post-translational modification of recombinant BMP-15 mature protein (P16 and P17); findings are the first knowledge of the structure of rhBMP-15 mature protein toward understanding the molecular basis of BMP-15 function PMID: 18227435

Show More

Hide All

Involvement in disease
Ovarian dysgenesis 2 (ODG2); Premature ovarian failure 4 (POF4)
Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

HGNC: 1068

OMIM: 300247

KEGG: hsa:9210

STRING: 9606.ENSP00000252677

UniGene: Hs.532692

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*