Very nice to receive your inquiry.This full length protein is a transmembrane protein contains 7 transmembrane domains, we can only provide the full length protein with the cell free expression system,
and we can provide the partial protein by the other four regular expression systems:
Recombinant Human C-C chemokine receptor type 6(CCR6)
CSB-CF004845HU N-terminal 6xHis-tagged
CSB-CF004845HUa2 N-terminal 6xHis-SUMO-tagged
Expression Region: 1-374aa; Full length.
Sequence:
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM
Recombinant Human C-C chemokine receptor type 6(CCR6),partial
CSB-YP004845HU1 >> Yeast
CSB-EP004845HU1 >> E.coli
CSB-BP004845HU1 >> Baculovirus
CSB-MP004845HU1 >> Mammalian cell
Expression Region: 1-47aa; Fragment at the C-terminal.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP, BP, MP: N-terminal 6xHis-tagged; EP: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Sequence:
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL
Regarding the activity, sorry, we haven't validated the activity, so their activity can't be 100% guaranteed. However, we have already successfully developed the full lengh CF proteins, and they are purified under very mild condition, in theory, they should be active, you can purchase a small amount to have a try.
Since you will use the protein for binding studies, we have developed two kinds of tags for CF proteins,you can check which one is more suitable for your experiment demand.
In theory, our current tags are suitable for your receptor ligand binding studies.
If you need biotin tag, we can provide N-terminal 6xHis-Avi-tagged (CSB-CF004845HUg2) or N-terminal 6xHis-tagged and C-terminal Avi-tagged(CSB-CF004845HUh2),
the prices are the same. Lead time is 25-35 working days.You can perform biotinylation in vitro based on either of these two tags.
Avi-tag itself can be biotinylated in vitro and in vivo.
In vivo, one method is to use a specific strain: https://www.avidity.com/avitag/avb-101-glycerol-stock-0
The other method is to build a co-expression, which is relatively difficult.
So these two kinds of in vivo biotinylated are not provided.
What we express is non-biotinylated protein. If you want biotinylation,you can purchase enzyme or kit for biotinylation in vitro. We do not provide this in vitro biotinylation labeling service.
You can refer to this link: https://www.avidity.com/avitag/bira-500-bira-biotin-protein-ligase-standard-reaction-kit
