| Code | CSB-YP004845HU1 |
| MSDS | |
| Size | Pls inquire |
| Source | Yeast |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP004845HU1-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-BP004845HU1 |
| MSDS | |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP004845HU1 |
| MSDS | |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
CSB-EP004845HU; CSB-YP004845HU; CSB-BP004845HU; CSB-MP004845HU Recombinant Human C-C chemokine receptor type 6 (CCR6)
Please can you provide sequence, pricing, availability and tag information for all available sizes of all available expression hosts?
I would like to use this protein for functional studies or more specifically for binding studies. Do you have any customer feedback for this protein on its functional activity? Also the customer would like a biotin tag or any other tag that they could use directly for this type of study. Is this something you can offer and if yes is there an additional cost?
Thank you !
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL