Recombinant Human C-C chemokine receptor type 6(CCR6),partial

Product Type Recombinant Protein
Uniprot No. P51684
Species Homo sapiens (Human)
Gene Names CCR6
Protein Names Recommended name: C-C chemokine receptor type 6 Short name= C-C CKR-6 Short name= CC-CKR-6 Short name= CCR-6 Alternative name(s): Chemokine receptor-like 3 Short name= CKR-L3 DRY6 G-protein coupled receptor 29
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Receptor for the C-C type chemokine CCL20
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell surface
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Sperm. Mainly localized in the tail and in the postacrosomal region but is also found in the midpiece and basal region in a small percentage of sperm cells. Reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein
Database Links

HGNC: 1607

OMIM: 601835

KEGG: hsa:1235

STRING: 9606.ENSP00000339393

UniGene: Hs.46468

Pathway Chemokine signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Human C-C chemokine receptor type 6(CCR6),partial,Yeast
Code CSB-YP004845HU1
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human C-C chemokine receptor type 6(CCR6),partial,E.coli
Code CSB-EP004845HU1
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human C-C chemokine receptor type 6(CCR6),partial,Baculovirus
Code CSB-BP004845HU1
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human C-C chemokine receptor type 6(CCR6),partial,Mammalian cell
Code CSB-MP004845HU1
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Protein Description Partial
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

CSB-EP004845HU; CSB-YP004845HU; CSB-BP004845HU; CSB-MP004845HU Recombinant Human C-C chemokine receptor type 6 (CCR6)
Please can you provide sequence, pricing, availability and tag information for all available sizes of all available expression hosts?
I would like to use this protein for functional studies or more specifically for binding studies. Do you have any customer feedback for this protein on its functional activity? Also the customer would like a biotin tag or any other tag that they could use directly for this type of study. Is this something you can offer and if yes is there an additional cost?
Thank you !

A:
Very nice to receive your inquiry.This full length protein is a transmembrane protein contains 7 transmembrane domains, we can only provide the full length protein with the cell free expression system,
and we can provide the partial protein by the other four regular expression systems:
Recombinant Human C-C chemokine receptor type 6(CCR6)
CSB-CF004845HU N-terminal 6xHis-tagged
CSB-CF004845HUa2 N-terminal 6xHis-SUMO-tagged
Expression Region: 1-374aa; Full length.
Sequence:

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM


Recombinant Human C-C chemokine receptor type 6(CCR6),partial
CSB-YP004845HU1 >> Yeast
CSB-EP004845HU1 >> E.coli
CSB-BP004845HU1 >> Baculovirus
CSB-MP004845HU1 >> Mammalian cell
Expression Region: 1-47aa; Fragment at the C-terminal.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP, BP, MP: N-terminal 6xHis-tagged; EP: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.
Sequence:

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL


Regarding the activity, sorry, we haven't validated the activity, so their activity can't be 100% guaranteed. However, we have already successfully developed the full lengh CF proteins, and they are purified under very mild condition, in theory, they should be active, you can purchase a small amount to have a try.
Since you will use the protein for binding studies, we have developed two kinds of tags for CF proteins,you can check which one is more suitable for your experiment demand.
In theory, our current tags are suitable for your receptor ligand binding studies.

If you need biotin tag, we can provide N-terminal 6xHis-Avi-tagged (CSB-CF004845HUg2) or N-terminal 6xHis-tagged and C-terminal Avi-tagged(CSB-CF004845HUh2),
the prices are the same. Lead time is 25-35 working days.You can perform biotinylation in vitro based on either of these two tags.
Avi-tag itself can be biotinylated in vitro and in vivo.
In vivo, one method is to use a specific strain: https://www.avidity.com/avitag/avb-101-glycerol-stock-0
The other method is to build a co-expression, which is relatively difficult.
So these two kinds of in vivo biotinylated are not provided.

What we express is non-biotinylated protein. If you want biotinylation,you can purchase enzyme or kit for biotinylation in vitro. We do not provide this in vitro biotinylation labeling service.
You can refer to this link: https://www.avidity.com/avitag/bira-500-bira-biotin-protein-ligase-standard-reaction-kit
Customer Reviews

Related Products

CCR6 Antibodies

CCR6 Antibodies for Human

CCR6 Antibodies for Homo sapiens (Human)

CCR6 Proteins

CCR6 Proteins for Homo sapiens (Human)

CCR6 ELISA Kit

CCR6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.