Recombinant Human C-C chemokine receptor type 6 (CCR6), partial

In Stock
Code CSB-EP004845HU1
Abbreviation Recombinant Human CCR6 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CCR6; CKRL3; CMKBR6; GPR29; STRL22; C-C chemokine receptor type 6; C-C CKR-6; CC-CKR-6; CCR-6; Chemokine receptor-like 3; CKR-L3; DRY6; G-protein coupled receptor 29; GPR-CY4; GPRCY4; LARC receptor; CD antigen CD196
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-47aa
Target Protein Sequence
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels. Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins. Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity. Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/ memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma. CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for the normal migration of Th17 cells in Peyers-patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine. Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs). Required for optimal differentiation of DN2 and DN3 thymocyte precursors. Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches. Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells. Positively regulates sperm motility and chemotaxis via its binding to CCL20.
Gene References into Functions
  1. Co-culture with BD2 and BD3 led to up-regulation of CD4+ T cell proliferation after 72 h whereas, CD4+ T cell proliferation was suppressed after 96 h. On the other hand, CCR6- and CCR6+ T cell proliferation was up-regulated after 72 h. PMID: 30098283
  2. Identified a population of gut-derived TREG cells producing CCR6 and CXCR6 which are significantly reduced in inflammatory bowel disease. PMID: 29981781
  3. CCR6 facilitates tumor angiogenesis via the AKT/NF-kappaB/VEGF pathway in colorectal cancer PMID: 29097259
  4. expression increased on B cells of systemic lupus erythematosus patients PMID: 28444576
  5. In conclusion, it seems that decreased expression of CXCR3 and higher expression of CCR6 were associated with HTLV-1 infection, what indicate that these alterations may favor virus dissemination but not disease manifestation. PMID: 28206670
  6. Bin1-N-BAR domains assemble into scaffolds of low long-range order that form flexible membrane tubule in the sarcolemma PMID: 27016283
  7. CCR6 defines memory B cell precursors in mouse and human germinal centers, revealing light-zone location and predominant low antigen affinity. PMID: 29262350
  8. High expression of CCR6 is associated with cutaneous T-cell lymphoma. PMID: 26789110
  9. CCR6(-) regulatory T cells blunt the restoration of gut Th17 cells along the CCR6-CCL20 axis in treated HIV-1-infected patients. PMID: 26883727
  10. results provide a potential explanation for involvement of the CCL20-CCR6 system in the trafficking of IL-17-producing cells to degenerated IVD tissues PMID: 23823618
  11. High CCR6 expression is associated with B-lymphoblastic lymphoma with inflammation. PMID: 27018255
  12. CCR6 expression was higher in cells derived from node-positive cases and highest expression was in cells derived from metastatic cases of colon cancer. PMID: 27149649
  13. The study suggests that a genetic interaction between DPP4 and CCR6 is involved in RA susceptibility PMID: 27587881
  14. point mutations in CCR6 can result in either a gain or loss of receptor function PMID: 27789680
  15. Rheumatoid arthritis-associated double nucleotide polymorphism in CCR6 regulates CCR6 via PARP-1. PMID: 27626929
  16. This study evaluated the role of CCL20 and CCR6 in the regulation of laryngeal neoplasms; it showed that these proteins acted on proliferation and metastasis via the p38 pathway and multiple microRNAs. PMID: 27916417
  17. CCR6 expression may be a novel biomarker for predicting clinical outcomes for gastric cancer patients. PMID: 26489425
  18. Cell migration assays showed that TNF-alpha treatment significantly increased the rate of migrated cells in those cells in which it also increased the membrane expression of CCR6 (TPC-1 and BCPAP) as compared to basal condition PMID: 26577851
  19. There were early increased plasma concentrations of CCL20 and CCR6 in patients with sepsis. CCL20 and CCR6 correlate with severity of illness in ICU patients. Levels of CCR6 predicted the length of patients' admission. PMID: 26771764
  20. High CCR6 expression is associated with Inflammatory Bowel Disease. PMID: 26536229
  21. Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment PMID: 26345847
  22. AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer. PMID: 26156805
  23. The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.Expression of nucleolin and CCR6 correlates with overall survival in hepatocellular carcinoma patients. PMID: 25698534
  24. Late-onset cytomegalovirus infection was preceded by an immune phenotype characterized by increased CCR6 expression on bulk CD4(+) T cells following solid organ transplant. PMID: 25690781
  25. The data reviewed suggest the necessity of evaluation of other blood redox-balance and nitric oxide in psoriasis should with additional investigations to targeting CCR6 rs3093024 in the genetic susceptibility of psoriasis. PMID: 25879557
  26. the current data demonstrate a genetic association between CCR6 variants and susceptibility to lupus nephritis PMID: 26138531
  27. Th17 cells are recruited into tumor tissues preferentially through CCR6-CCL20 pathway PMID: 25768730
  28. High CCR6 expression is associated with colon cancer. PMID: 24866282
  29. Leukocytes expressing CCR6 are present in the ovary immediately prior to ovulation. PMID: 26125463
  30. The data of this study suggested that CCR6 expression, which shows an increase in both moderatesevere and mild Alaheimer disease patients, is related to the pathological process underlying Alzaheimer disease. PMID: 25408215
  31. CCR6 SNPs are a risk factor for presence of anti-topoisomerase I antibodies in systemic sclerosis. PMID: 26314374
  32. CCL20 cooperated with CCR6 could recruit T regulatory cells to tumor sites, and chemotherapy medicine docetaxel could decrease the expression of CCL20. PMID: 25661365
  33. hBD-3 stimulates IL-37 expression through CCR6 in keratinocytes PMID: 25541254
  34. RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population PMID: 25928629
  35. PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells. PMID: 25833398
  36. CKR-L3 with other minor coreceptors may contribute to HIV and SIV pathogenesis including dissemination, trafficking and latency especially when major coreceptors become compromised. PMID: 24980635
  37. These findings support the hypothesis that CCR6 up-regulation stimulated by IL-17 may play an active role in colorectal cancer cell migration. PMID: 25201147
  38. The tumor expression of CCR6 plays a critical role in colorectal cancer metastasis. PMID: 24979261
  39. CCR6/CCL20 biological axis increased the capacity of proliferation and adhesion, as well as the chemotactic migration and the level of cytokines related to degraded extracellular matrix. PMID: 24743888
  40. genetic and biological role of the C-C chemokine ligand CCL20 and the C-C chemokine receptor CCR6in rheumatoid arthritis, is discussed.[review] PMID: 24394994
  41. CCR6 is highly expressed in thyroid cancer cells.CCR6 promotes the invasion and migration of thyroid cancer cells via NF-kappa B signaling-induced MMP-3 production. PMID: 24984269
  42. CCR6+ naive precursors contain a predetermined reservoir to replenish IL-17-secreting cells and may have implications in balancing the Th17 effector and IL-17+ Treg compartments that are perturbed during HIV infection. PMID: 24958901
  43. CCR6 protein level was higher in hepatocellular carcinoma (HCC) than in adjacent noncancerous tissues. CCR6 expression correlated with multicentricity and vascular invasion. CCR6 expression was an independent prognostic factor for overall survival. PMID: 24634224
  44. CCR6 expression is regulated by miR-518a-5p in colorectal cancer cells. PMID: 24559209
  45. DPP4, CDK5RAP2, and CCR6 are risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans. PMID: 24782177
  46. interfering with IL-1beta and IL-12 signaling in Th17 cells during inflammation may be a promising therapeutic approach to reduce their differentiation into "pathogenic" CCR6+ CXCR3+ Th1/17 cells in patients with autoimmune diseases. PMID: 24890729
  47. Dendritic and T cells in psoriasis express CCL20 and CCR6 as part of the pathology. PMID: 24401998
  48. High CCR6/CCR7 expression and Foxp3 positive T regulatory cell number are positively related to the progression of laryngeal squamous cell carcinoma PMID: 23835793
  49. A CCR6 variant strongly associated with rheumatoid arthritis in two populations is not associated with ankylosing spondylitis. PMID: 22527137
  50. Chemokine receptor CCR6-dependent accumulation of gammadelta T cells in injured liver restricts hepatic inflammation and fibrosis. PMID: 23959575

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell surface.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Sperm. Mainly localized in the tail and in the postacrosomal region but is also found in the midpiece and basal region in a small percentage of sperm cells. Reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein
Database Links

HGNC: 1607

OMIM: 601835

KEGG: hsa:1235

STRING: 9606.ENSP00000339393

UniGene: Hs.46468

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*