Recombinant Human CMRF35-like molecule 7(CD300LB),partial

Code CSB-YP004919HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. A8K4G0
Relevance Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD300 antigen-like family member BCMRF35-A2Immune receptor expressed on myeloid cells 3Short name:IREM-3Leukocyte mono-Ig-like receptor 5Triggering receptor expressed on myeloid cells 5Short name:TREM-5CD_antigen: CD300b
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
Research Area Others
Source Yeast
Gene Names CD300LB
Protein Names Recommended name: CMRF35-like molecule 7 Short name= CLM-7Alternative name(s): CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name= IREM-3 Leukocyte mono-Ig-like receptor
Expression Region 18-151aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 17.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families CD300 family
Tissue Specificity Expressed exclusively in myeloid lineages.
Database Links

HGNC: 30811

OMIM: 610705

KEGG: hsa:124599

STRING: 9606.ENSP00000376397

UniGene: Hs.313343

Related Products

CD300LB Antibodies

CD300LB Antibodies for Homo sapiens (Human)

CD300LB Proteins

CD300LB Proteins for Homo sapiens (Human)

CD300LB ELISA Kit

CD300LB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.