Recombinant Human Carboxypeptidase E (CPE), partial

In Stock
Code CSB-EP005886HU
Abbreviation Recombinant Human CPE protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CPE
Uniprot No.
Research Area
Neuroscience
Alternative Names
(CPE)(Carboxypeptidase H)(CPH)(Enkephalin convertase)(Prohormone-processing carboxypeptidase)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
252-363aa
Target Protein Sequence
LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sorting receptor that directs prohormones to the regulated secretory pathway. Acts also as a prohormone processing enzyme in neuro/endocrine cells, removing dibasic residues from the C-terminal end of peptide hormone precursors after initial endoprotease cleavage.
Gene References into Functions
  1. Our results implicate a novel role for Carboxypeptidase E that mainly affects the expression of motility-associated genes via several signal pathways PMID: 28656234
  2. This study has uncovered a human CPE/NF-alpha1 gene mutation that could lead to comorbidity of dementia and depression, emphasizing the importance of this gene in cognitive function. PMID: 27922637
  3. CPE through its N'-terminal sequence, forms aggregates with Wnt3a and possible endoplasmic reticulum (ER) stress leading to its loss of function. PMID: 27375026
  4. we have identified a novel SNP in the CPE gene which results in the loss of its neuroprotective function in cells and may confer neurological disorders in humans PMID: 28114332
  5. High-level CPE [ carboxypeptidase E] expression was associated with a poor prognosis in early-stage cervical cancer. CPE may serve as a biomarker for predicting PLNM [ pelvic lymph node metastasis ] and survival in these patients. PMID: 26695643
  6. Low carboxypeptidase E expression is associated with recurrence in early-stage hepatocellular carcinoma. PMID: 26803519
  7. Down-expression of liver carboxypeptidase E may reduce the secretion of serum cholecystokinin and contribute to the formation of cholesterol gallstone. PMID: 26228366
  8. Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer. PMID: 25374060
  9. Disruption of insulin receptor (IR) expression in beta cells has a direct impact on the expression of the convertase enzyme carboxypeptidase E (CPE) by inhibition of the eukaryotic translation initiation factor Eif4g1. PMID: 24843127
  10. Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer. PMID: 24006921
  11. Data suggest that splice variant of carboxypeptidase E (CPE-DeltaN) that CPE-DeltaN expression might be a potential prognostic marker for colorectal cancer patients. PMID: 23852859
  12. CPE is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested PMID: 22998035
  13. CPE forms a complex, probably through sequences located at its N-terminal domain, with Wnt3a and the extracellular cysteine rich domain of Fz1. PMID: 22824791
  14. Neither high glucose nor insulin (with low glucose) regulates beta-cell CPE (but either up-regulates CPD). PMID: 21628999
  15. an N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers PMID: 21285511
  16. CPE may play a role in promoting tumor growth and invasion. PMID: 21061162
  17. Carboxypeptidase E is differently expressed in subcutaneous and visceral fat of obese subjects PMID: 12530526
  18. protein binding with Con A in seminal plasma PMID: 14690244
  19. cDNA microarray analysis led to the identification of 2 novel biomarkers that should facilitate molecular diagnosis and further study of pulmonary neuroendocrine tumors. PMID: 15492986
  20. A possible role for mutations in CPE in the development of coronary heart disease. PMID: 17957445
  21. the severity of the coronary atherosclerosis estimated by Gensini score was significantly influenced by the presence of the A2925G mutant and G2855A mutant of the CPE gene PMID: 18080843
  22. polymorphism in the CPE exon5 gene may contribute to the angiographical characteristics of coronary atherosclerosis in the Chinese population PMID: 18501121
  23. Carboxypeptidase E degradation contributes to palmitate-induced beta-cell ER stress and apoptosis; CPE is a major link between hyperlipidemia and beta-cell death pathways in diabetes. PMID: 18550819
  24. CPH-Abs may allow discrimination of a more latent subset of adult-onset autoimmune diabetes (LADA). PMID: 19120309
  25. Carboxypeptidase E may be a key molecule to regulate Caspr2 (carboxypeptidase E) trafficking to the cell membrane. PMID: 19166515
  26. missense polymorphism encoding altered activity PMID: 11462236

Show More

Hide All

Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, secretory vesicle. Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Secreted.
Protein Families
Peptidase M14 family
Database Links

HGNC: 2303

OMIM: 114855

KEGG: hsa:1363

STRING: 9606.ENSP00000386104

UniGene: Hs.75360

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*