Recombinant Human Caspase-14 (CASP14)

Code CSB-EP004546HU
Abbreviation Recombinant Human CASP14 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CASP14
Uniprot No.
Research Area
Cell Biology
Alternative Names
Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
153-240aa
Target Protein Sequence
KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum. Seems to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin. In vitro has a preference for the substrate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF. Involved in processing of prosaposin in the epidermis. May be involved in retinal pigment epithelium cell barrier function. Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD.
Gene References into Functions
  1. High CASP14 expression is a marker of breast cancer aggressiveness in association with proliferation, TNBC phenotype, and cancer stemness. PMID: 28570747
  2. overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14 PMID: 25651379
  3. caspase-14 contributes to retinal pigment epithelium cell barrier disruption under hyperglycemic conditions. PMID: 25121097
  4. Caspase-14 was decreased in inflammatory lesions compared to non-lesion in atopic dermatitis. The amount of caspase-14 in the lesions correlated with clinical severity as determined by eczema area and severity index score and the skin barrier functions. PMID: 25315296
  5. Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models. PMID: 24872419
  6. partial loss of caspase 14 is not associated with dedifferentiation in neoplastic lesions of the oral mucosa PMID: 23645350
  7. genetic polymorphisms in AICDA and CASP14 are associated with risk for brain tumor in Korean children. PMID: 23408445
  8. Suggest caspase-14 is a marker of human skin differentiation during development. PMID: 23377137
  9. Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development. PMID: 23580611
  10. ceramides, an important structural lipid, stimulate caspase-14 expression, coordinating formation of lipid lamellar membranes with the formation of corneocytes PMID: 23362869
  11. Caspase-14 might play a significant role in the pathogenesis of diabetic retinopathy by accelerating retinal endothelial and epithelial cells death. PMID: 22876114
  12. regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14. PMID: 22825846
  13. genetic polynorphism is associated with the risk of childhood leukemia PMID: 22548721
  14. A strong association was evident between GATA-3 and caspase-14 expression in preinvasive ductal carcinoma in situ samples, where GATA-3 also displayed prognostic significance PMID: 21930782
  15. Regulation of caspase 14 levels provides a possible link between impaired skin barrier function and inflammatory reactions in skin diseases such as atopic dermatitis and may offer an explanation to the skin barrier dysfunction in inflamed skin lesions. PMID: 21539619
  16. Casp-14 overexpression correlated with tumor stage, cell differentiation and lymphovascular involvement, suggesting that casp-14 was associated with tumor cell growth and metastatic potential. PMID: 21567094
  17. Caspase 14 is a cysteine protease and is inhibited by full-length LEKTI and 5 recombinant fragments of LEKTI to varied extents. PMID: 20533828
  18. Purification and characterization of active caspase-14 from human epidermis and development of the cleavage site-directed antibody PMID: 19960512
  19. Results imply that caspase-14 inhibits trophoblast differentiation. PMID: 19747408
  20. processing of caspase 14 in epidermal differentiation PMID: 12200134
  21. caspase-14, similarly to other keratinocyte differentiation-associated proteins, is downregulated by retinoids, suggesting that this caspase plays a part in terminal keratinocyte differentiation and skin barrier formation PMID: 12445205
  22. Loss of caspase-14 expression is associated with psoriatic lesions PMID: 15331408
  23. psoriatic keratinocytes may activate mechanisms that prevent the nuclear entry of caspase 14 PMID: 15619438
  24. caspase-14 is aberrantly expressed in epithelial tumors PMID: 16061209
  25. there are tumor-specific alterations in caspase-14 expression which may define subsets of epithelial cancers with distinct clinical behaviors PMID: 16061862
  26. Caspase-14 is present in the human placenta, primarily in the trophoblast, but its function is not clear PMID: 16168224
  27. caspase-14 has a substrate specificity similar to the group I caspases, and demonstrate that it functions in a distinct manner from executioner caspases to carry out specific proteolytic events during keratinocyte differentiation. PMID: 16854378
  28. caspase-14 is up-regulated during trophoblast differentiation, as represented by the BeWo cell line PMID: 17359582
  29. Expression of exogenous caspase-14 led to growth inhibition and reduced the tumorigenicity of A431 skin cancer cells. PMID: 17436577
  30. caspase-14 gene is rarely mutated in colorectal carcinomas, but not mutated in gastric, lung, breast and hepatocellular carcinomas PMID: 17558860
  31. These data reveal the basic organization of the human caspase-14 promoter and suggest an important role of AP-1 and NFkappaB in the transcriptional control of caspase-14. PMID: 18424262
  32. Expression of caspase 6 and caspase 14 genes were different between normal skin of keloid-prone individuals and normal skin of keloid-resistant patients. PMID: 18762957

Show More

Hide All

Involvement in disease
Ichthyosis, congenital, autosomal recessive 12 (ARCI12)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Peptidase C14A family
Tissue Specificity
Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only exp
Database Links

HGNC: 1502

OMIM: 605848

KEGG: hsa:23581

STRING: 9606.ENSP00000221740

UniGene: Hs.466057

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*