Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45
Species
Homo sapiens (Human)
Expression Region
120-269aa
Target Protein Sequence
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 120-269 form the expressed segment for recombinant Human CASP1. The theoretical molecular weight of the CASP1 protein is 43.8 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of CASP1, making it easier to detect and purify the CASP1 recombinant protein in the later stages of expression and purification.
Caspase-1 (CASP1) is a crucial enzyme primarily involved in the regulation of inflammation and apoptosis. One of its key research areas is its role in immune system inflammation regulation. CASP1 is a critical component of the inflammasome, triggering inflammatory responses by activating pro-inflammatory cytokines IL-1β and IL-18, contributing to infection defense and maintaining immune balance. CASP1 is also a subject of interest in the study of inflammatory diseases, showing close associations with autoimmune diseases, neuroinflammation, and the inflammatory processes related to tumors. Researchers aim to uncover the precise regulatory mechanisms of CASP1 in the development of these diseases, hoping to develop relevant therapeutic strategies. Additionally, CASP1 plays a crucial role in the regulation of apoptosis, being involved in the activation of the non-canonical apoptosis pathway, which is essential for maintaining the normal physiological balance of tissues and organs.
