Recombinant Human Caspase-1 (CASP1), partial

In Stock
Code CSB-EP004543HU1
Abbreviation Recombinant Human CASP1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
CASP-1; CASP1; CASP1_HUMAN; Caspase 1; Caspase-1 subunit p10; ICE; IL-1 beta-converting enzyme; IL-1BC; IL1 beta converting enzyme; IL1B convertase; Interleukin 1 beta convertase; Interleukin 1B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
120-269aa
Target Protein Sequence
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 120-269 form the expressed segment for recombinant Human CASP1. The theoretical molecular weight of the CASP1 protein is 43.8 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of CASP1, making it easier to detect and purify the CASP1 recombinant protein in the later stages of expression and purification.

Caspase-1 (CASP1) is a crucial enzyme primarily involved in the regulation of inflammation and apoptosis. One of its key research areas is its role in immune system inflammation regulation. CASP1 is a critical component of the inflammasome, triggering inflammatory responses by activating pro-inflammatory cytokines IL-1β and IL-18, contributing to infection defense and maintaining immune balance. CASP1 is also a subject of interest in the study of inflammatory diseases, showing close associations with autoimmune diseases, neuroinflammation, and the inflammatory processes related to tumors. Researchers aim to uncover the precise regulatory mechanisms of CASP1 in the development of these diseases, hoping to develop relevant therapeutic strategies. Additionally, CASP1 plays a crucial role in the regulation of apoptosis, being involved in the activation of the non-canonical apoptosis pathway, which is essential for maintaining the normal physiological balance of tissues and organs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides. Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a proinflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes. Cleaves a tetrapeptide after an Asp residue at position P1. Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD. In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.; Apoptosis inactive.; Apoptosis inactive.
Gene References into Functions
  1. ABT-737 elicited an anti-atopic dermatitis (AD) activity via suppression of caspase-1 activation in AD in vitro and in vivo models. Therefore, this study provides important information regarding the use of anticancer drugs for controlling allergic inflammatory diseases. PMID: 29957081
  2. Cryo-EM structures of ASC and NLRC4 CARD filaments reveal a unified mechanism of nucleation and activation of caspase-1 PMID: 30279182
  3. The increased expression of NLRP3 and caspase-1 in fetal membrane and placental tissues may be associated with the development of premature rupture of membrane. PMID: 29545514
  4. inflammasome activation and pyroptosis in human microglia and ODCs in vitro after exposure to inflammatory stimuli and demonstrate caspase-1 inhibition by the small-molecule inhibitor VX-765 in both cell types. GSDMD inhibition by siRNA transduction suppressed pyroptosis in human microglia. PMID: 29895691
  5. Increased production of caspase-1 in the gut-associated lymphoid tissue and peripheral blood of HIV infected patients. PMID: 29672590
  6. Low CASP1 expression is associated with prostate cancer. PMID: 28388569
  7. These findings confirm the involvement of caspase-1 in non-classical secretion mechanisms and open novel perspectives for the extracellular function of secreted GBP-1. PMID: 28272793
  8. this study demonstrates that the G+7/in6A and A10370-G polymorphisms of the CASP1 gene are associated with increased risk of developing acute coronary syndrome in Mexican population PMID: 28456882
  9. After genotype calling and quality control filtering with exclusion of 3 cases and 3 controls, association analysis was performed across 76 directly genotyped SNPs in NLRP1, CARD, and CASP1 genes, adjusting for age, sex, and population stratification PMID: 29438387
  10. Caspase-1 role in pyroptosis in glioma cells.Mir-214 regulates caspase-1 expression in glioma. PMID: 28244850
  11. Data show that cyclic stretch activated the nucleotide-binding oligomerization domain-like receptor containing pyrin domain 1 and 3 (NLRP1 and NLRP3) inflammasomes and induced the release of IL-1beta and pyroptosis via a caspase-1-related mechanism in human periodontal ligament cells (HPDLCs). PMID: 27626170
  12. Caspase-1 directly cleaves alpha-Synuclein, generating a highly aggregation-prone species in neurons. PMID: 27482083
  13. the activation of Rho GTPases by the CNF1 toxin during E. coli-triggered bacteremia leads to a GR1(+)cell-mediated efficient bacterial clearing and improves host survival. Host alarm requires the Caspase-1/IL-1beta signaling axis. PMID: 26492464
  14. Nodakenin inhibited the mRNA expression and production of pro-inflammatory cytokines and caspase-1 activation PMID: 28407357
  15. sickle red blood cell induced TLR9, NLRP3, Caspase-1, IL-1beta and IL-18 expression and induced IL-1beta, LTB4 and nitrite production in PBMC cultures. PMID: 27045344
  16. Data show that the serine protease inhibitor B9 (serpinB9) mediated caspase-1 inhibition regulates IL-1beta release in monocytes. PMID: 26992230
  17. study uncovers a novel mechanism of G9A promoting tumor cell growth and invasion by silencing CASP1, and implies that G9A may serve as a therapeutic target in treating Non-small-cell lung cancer. PMID: 28383547
  18. Caspase-1 polymorphisms may play a role in Chagas cardiomyopathy development and could serve as markers to identify individuals at higher risk for priority treatment. PMID: 28954073
  19. besides its role in the inhibition of the NF-kappaB pathway, NLRC3 interferes with the assembly and activity of the NALP3 inflammasome complex by competing with ASC for pro-caspase-1 binding PMID: 28584053
  20. Data, including data from studies using recombinant fusion forms of GSDMD (gasdermin D), suggest that GSDMD participates in inflammasome-dependent pyroptosis of macrophages in response to various stimuli; this mechanism involves proteolysis of GSDMD by caspase-1 and caspase-11. PMID: 28726636
  21. Proteases caspase-1 and caspase-8 have redundant roles in cleaving IL-1beta and promoting osteomyelitis. [review] PMID: 27148834
  22. Patients with NLRP1-associated autoinflammation with arthritis and dyskeratosis syndrome had increased systemic CASP1. PMID: 27965258
  23. The biochemical function of NLPR3 inflammasomes is to activate caspase-1, which leads to the maturation of interleukin 1 beta and IL-18 and the induction of pyroptosis, a form of cell death. (Review) PMID: 27669650
  24. The structure of the human caspase-1 CARD domain (caspase-1(CARD)) filament solved by cryo-electron microscopy. PMID: 27043298
  25. Caspase-1-mediated downregulation of PPARgamma was important in the late stage of monocyte-macrophage differentiation; however, PPARgamma protein levels had little effect on the early stage differentiation. PMID: 28052562
  26. Inflammasome NLRP3-caspase-1-mediated degradation of smooth muscle cell contractile proteins may contribute to aortic biomechanical dysfunction and aortic aneurysm/dissection development. PMID: 28153878
  27. Study demonstrates that the expression of the NLRP3-caspase-1-IL-18 axis is highly expressed in the peripheral blood mononuclear cells of patients with bullous pemphigoid (BP), and correlated with disease activity, suggesting its involvement in the pathogenesis and progression of BP. PMID: 27174093
  28. High expression of CASP1 is associated with osteosarcoma. PMID: 28000894
  29. This study demonstrated that dysregulated expression of NLRP3-caspase-1-IL-1beta axis was observed in patients with MM, suggesting they might be involved in the pathogenesis of MM. PMID: 26146985
  30. The NLRP3/caspase-1/IL-1beta axis is active in cartilaginous endplates of patients with Modic changes and inflammatory cascades can exacerbate the cartilaginous endplate degeneration which may act as a trigger for intervertebral disc degeneration and low back pain. PMID: 27146654
  31. High expression of NLRP3, NLRC4, and CASP1 in background non-tumorous liver is significantly correlated with poor prognosis of patients after resection of hepatocellular carcinoma. PMID: 28011505
  32. The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media. PMID: 26457439
  33. The results indicate that acteoside may act as a regulator of the IL-32 induced immune responses. PMID: 26453510
  34. These results suggest that released caspase-1 exists in a unique complex that is functionally stable and protected from immunodepletion whereas cell-extract generated active caspase-1 is rapidly inhibited in the cytosolic milieu. PMID: 26599267
  35. Genetic polymorphisms in Nalp3 and caspase-1 may be associated with individual susceptibility to silicosis, especially when the polymorphisms interact with age, cumulative dust exposure, or smoking status. PMID: 26496436
  36. In contrast, inhibition of the protease activity of Kgp, RgpA or RgpB increased the human caspase-1-activating potential of wild-type Porphyromonas gingivalis, indicating an inhibitory effect of the collaborative action of gingipains. PMID: 25759090
  37. NLRP3 and caspase-1 are expressed in the odontoblast layers in normal human dental pulp tissue, whereas in inflamed pulp tissue, the odontoblast layers are disrupted and dental pulp cells are positive for NLRP3 and caspase-1. PMID: 25684031
  38. the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation PMID: 26240347
  39. specific caspase cleavage sites in Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome PMID: 26218605
  40. three cofactor independent human monoclonal aPL can induce transcription of NLRP3 and caspase-1 resulting in inflammasome activation specific for NLRP3, which depends fully on activation of endosomal NADPH-oxidase-2 (NOX2) by aPL PMID: 25589411
  41. Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes. PMID: 26466953
  42. In patients with HIV, serum CASP1 levels in a group with high CD4 cell counts increased rapidly then decreased within a short time during early HIV-1 infection. In contrast, CASP1 levels in the CD4Low group were increased after 1 year of HIV-1 infection. PMID: 25806508
  43. production of 20-kDa IL-1beta may act to limitIL-1beta signaling by reducing the pool of pro-IL-1beta availability for caspase-1 cleavage PMID: 26324708
  44. The study shows that A1AT does not inhibit human monocyte caspase-1. PMID: 25658455
  45. Data suggest activation of CASP1 (caspase-1) and secretion of IL18 (interleukin 18)/IFNG (interferon-gamma) in mucosal explants of ileum/colon are related to intensity of inflammatory lesions in patients with active, long-standing Crohn's disease. PMID: 26168332
  46. Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2 PMID: 26324711
  47. the inflammatory CASP1 is linked to several genes involved in cholesterol homeostasis. These correlations resulted in altered GBM (Glioblastoma Multiforme), in particular for CASP1 PMID: 25330190
  48. caspase 1 was higher in degenerated intervertebral discs than in healthy controls. PMID: 25284686
  49. ASC interacts with NALP3 and caspase-1 via different domains. PMID: 25567507
  50. Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever. PMID: 26510601

Show More

Hide All

Subcellular Location
Cytoplasm. Cell membrane.
Protein Families
Peptidase C14A family
Tissue Specificity
Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.
Database Links

HGNC: 1499

OMIM: 147678

KEGG: hsa:834

STRING: 9606.ENSP00000410076

UniGene: Hs.2490

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*