Recombinant Human Caspase-1(CASP1),partial

In Stock
Code CSB-RP058244he0
Product Type Recombinant Protein
Size US$162Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P29466
Lead Time 3-7 business days
Relevance Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory elent binding proteins (SREBPs). Can also promote apoptosis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interleukin-1 beta convertase ;IL-1BCInterleukin-1 beta-converting enzyme ;ICE ;IL-1 beta-converting enzymep45
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Research Area Apoptosis
Source E.coli
Gene Names CASP1
Expression Region 120-269aa
Tag Info N-terminal GST-tagged
Mol. Weight 43.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive
Subcellular Location Cytoplasm
Protein Families Peptidase C14A family
Tissue Specificity Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.
Database Links

HGNC: 1499

OMIM: 147678

KEGG: hsa:834

STRING: 9606.ENSP00000410076

UniGene: Hs.2490

Pathway Lipids and Inflammation in Atherogenesis
Necroptosis
NOD-like receptor signaling pathway

Related Products

CASP1 Antibodies

CASP1 Antibodies for Human

CASP1 Antibodies for Homo sapiens (Human)

CASP1 Proteins

CASP1 Proteins for Homo sapiens (Human)

CASP1 ELISA Kit

CASP1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.