Name: Recombinant Human Caspase-7(CASP7),partial
Brand: CUSABIO
SKU: CSB-RP154794h(A3)

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	CASP7
Uniprot No.	P55210
Research Area	Apoptosis
Alternative Names	apoptosis-related cysteine peptidase; Apoptotic protease Mch-3; CASP-7; CASP7; CASP7_HUMAN; Caspase-7 subunit p11; CMH-1; ICE-LAP3; ICE-like apoptotic protease 3
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	24-198aa
Target Protein Sequence	AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	23.7kDa
Protein Length	Partial
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function (From Uniprot)	Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-\|-Gly-217' bond. Overexpression promotes programmed cell death.
Gene References into Functions	Pyrin signaling is dispensable for Clostridium difficile infection (CDI) associated intestinal epithelial cells death and for in vivo pathogenesis; C. difficile enterotoxins induce activation of executioner caspases 3/7 via the intrinsic apoptosis pathway indicating that caspase-3/7-mediated intestinal epithelial cells apoptosis is critical for in vivo host defense during early stages of CDI. PMID: 30451870 CASP8: rs1045494 (C > T), PIK3R1: rs3756668 (A > G) and CASP7: rs4353229 (T > C), were associated with longer overall survival in limited disease-small cell lung cancer patients after chemoradiotherapy PMID: 26988918 Results show that caspase-7 is phosphorylated by PAK2 at S239 which inhibits its activity by two divergent mechanisms prior to and following caspase activation: initial phosphorylation allosterically slows activation by upstream initiator caspases by impeding cleavage at the intersubunit linker and a second phosphorylation site directly blocks substrate binding. PMID: 27889207 Caspase-7 regions involved in the interaction with Hsp90 co-chaperone p23 and substrate recognition. PMID: 28863261 Study provides evidence that a loss-of-function variant rs10553596 in CASP7 associates with significantly reduced Alzheimer's disease incidence in elder populations. PMID: 27358062 Low expression of CASP7 is associated with non-small cell lung cancer. PMID: 26307684 Compared with the TT genotype, the rs10787498GT genotype was associated with an increased cervical cancer risk. PMID: 25784056 Phosphorylate caspase-7 bu Src at multiple tyrosine sites enhanced its cellular apoptotic effect. PMID: 24407236 Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population. PMID: 24040159 showed that CASP7 is downregulated in primary prostate tumors and metastatic lesions across multiple data sets PMID: 22986525 Genetic variations of CASP7 may modulate overall survival and progress-free survival of patients with advanced non-small cell lung cancer treated with platinum-based chemotherapy. PMID: 22441531 genetic polynorphism is associated with the risk of childhood leukemia PMID: 22548721 XIAP does not function as a NEDD8-E3 ligase for caspase-7 in vivo PMID: 22584050 Cellular expression of caspase-7 lacking the critical lysine residues resulted in less-efficient PARP and p23 cleavage compared with cells expressing the wild-type peptidase. PMID: 22451931 identify serine 118 in the transactivation domain of YY1 as the site of CK2alpha phosphorylation, proximal to a caspase 7 cleavage site PMID: 22184066 Caspase-7 cleaves human TERT at residues E286 and D628 as part of the apoptosis pathway in cultured cells. PMID: 21936563 highly expressed PAK2 mediates chemotherapeutic resistance in human breast invasive ductal carcinoma by negatively regulating caspase-7 activity PMID: 21555521 The RIPK1 and CASP7 polymorphisms can be considered as possible prognostic markers for survival after curative resection in patients with colorectal cancer. PMID: 20567846 Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes. PMID: 21157428 Single Nucleotide Polymorphisms in CASP7 is asspciated with lung cancer. PMID: 20661084 caspase 7 cleavage of ORF57 may represent a cellular function against lytic KSHV infection PMID: 20159985 Specifically interfering with caspase-7 activation may hold therapeutic value for the treatment of cancer and inflammatory ailments. PMID: 19782763 Pro-CASP7 was detected in mitochondria, cytosol, nucleus, and microsomes of U937 cells. During TPA-induced differentiation, it moved to the mitochondria. PMID: 12145703 caspase 9 by itself can activate caspase 7 in the absence of the caspase 3-dependent pathway in TNF-alpha-induced apoptosis PMID: 12804035 the N-peptide of caspase 7 serves to physically sequester the caspase-7 zymogen in a cytosolic location that prevents access by upstream activators PMID: 12824163 our data suggest that the inactivating mutations of the CASPASE-7 gene might lead to the loss of its apoptotic function and contribute to the pathogenesis of some human solid cancers PMID: 12970753 caspase-7 is involved earlier than other effector caspases in apoptosis PMID: 14583630 cleavage of Claspin by caspase-7 inactivates the Chk1 signaling pathway PMID: 16123041 Caspase 7 activation is a prominent feature in periodontitis-associated tissue injury. PMID: 16213496 Promoters of CASP7 genes are modulated by prohibitin. PMID: 16918502 AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein synthesis including eIF3g cleavage. PMID: 17094969 observation indicates that neither CASP7 nor CASP8 mutation may occur in gastrointestinal lymphomas, and suggests that neither of them may play an important role in the development of gastrointestinal lymphomas PMID: 17532763 crystal structures show that the S2 pocket of caspase-7 can accommodate diverse residues PMID: 17697120 A reticulon protein is identified as one out of a selected number of caspase targets during apoptosis and as a novel substrate for Cdk1 and 2.[ PMID: 18072206 These results revealed that caspase-7 has a novel role during cell cycle progression at mitosis. PMID: 18459962 Valosin-containing protein was cleaved by both capspase-7 and caspase-3 in vitro and during apoptosis; degradomic approach to caspase-7 provides new candidate substrates and valuable clues to the specific function of caspase-7 in apoptosis PMID: 18596415 CASP7 (caspase 7) rs2227309 SNP was not associated with rheuatoid arthritis (RA) in a European Caucasian population. CASP7 isoforms alpha and beta could have an involvement in the apoptosis process in RA PMID: 18785314 Modulation of effector caspase-7 cleavage determines response of breast and lung tumor cell lines to chemotherapy. PMID: 19241192 Results show that caspase 7, as an SREBP-1/2 target, can be induced under mevalonate-restricting conditions, which might help overcome its shortage. PMID: 19323650 These findings suggest that genetic variants in caspase-3 and caspase-7 may play a role in endometrial cancer susceptibility. PMID: 19531679 Dissecting an allosteric switch in caspase-7 using chemical and mutational probes. PMID: 19581639 there is an an association between HCV core and HAX-1, which promotes 5-FU mediated p53-dependent caspase-7 activation and hepatocyte growth inhibition PMID: 19605487 Show More Hide All
Subcellular Location	Cytoplasm
Protein Families	Peptidase C14A family
Tissue Specificity	Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.
Database Links	HGNC: 1508 OMIM: 601761 KEGG: hsa:840 STRING: 9606.ENSP00000358327 UniGene: Hs.9216

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-RP154794h(A3)
Size	US$1726Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Caspase-7(CASP7),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage