Recombinant Human Cathepsin D(CTSD),partial

Code CSB-EP006187HU1e0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07339
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR
Research Area Neuroscience
Source E.coli
Gene Names CTSD
Expression Region 67-403aa
Tag Info N-terminal GST-tagged
Mol. Weight 63.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation
Involvement in disease Ceroid lipofuscinosis, neuronal, 10 (CLN10)
Subcellular Location Lysosome, Melanosome, Secreted, extracellular space
Protein Families Peptidase A1 family
Tissue Specificity Expressed in the aorta extracellular space (at protein level) (PubMed:20551380). Expressed in liver (at protein level) (PubMed:1426530).
Database Links

HGNC: 2529

OMIM: 116840

KEGG: hsa:1509

STRING: 9606.ENSP00000236671

UniGene: Hs.654447

Pathway Estrogen signaling pathway
Apoptosis
Autophagy

Related Products

CTSD Antibodies

CTSD Antibodies for Homo sapiens (Human)

CTSD Antibodies for Human

CTSD Proteins

CTSD Proteins for Homo sapiens (Human)

CTSD ELISA Kit

CTSD ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.