Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AI481912; CATF_HUMAN; Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf; EC 3.4.22.41
Species
Homo sapiens (Human)
Expression Region
273-484aa
Target Protein Sequence
PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 273-484 form the expressed segment for recombinant Human CTSF. The calculated molecular weight for this CTSF protein is 27.4 kDa. This CTSF protein is produced using e.coli expression system. The N-terminal 6xHis tag was fused into the coding gene segment of CTSF, making it easier to detect and purify the CTSF recombinant protein in the later stages of expression and purification.
The human cathepsin F protein (CTSF), belonging to the papain family of cysteine proteases, is a lysosomal cysteine protease involved in the degradation of proteins within lysosomes. CTSF is primarily localized in lysosomes, where it participates in the processing and turnover of intracellular proteins. It exhibits endopeptidase activity, cleaving peptide bonds within proteins and peptides. Research on CTSF encompasses its role in cellular proteolysis, antigen presentation, and immune responses. Understanding the function of CTSF contributes to insights into lysosomal biology, protein degradation pathways, and its potential implications in diseases associated with lysosomal dysfunction.
