Recombinant Human Cathepsin K(CTSK)

Code CSB-YP006192HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CTSK
Uniprot No. P43235
Research Area Signal Transduction
Alternative Names Cathepsin K; Cathepsin O; Cathepsin O1; Cathepsin O2; Cathepsin X; CATK_HUMAN; CTS02; Ctsk; CTSO; CTSO1; CTSO2; MGC23107; PKND; PYCD
Species Homo sapiens (Human)
Source Yeast
Expression Region 115-329aa
Target Protein Sequence APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 25.5kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Gene References into Functions
  1. Sclerostin is degraded by cathepsin K in vitro. Cathepsin K degradation of sclerostin is affected by hypoxia. PMID: 29859187
  2. Upregulation of CTSK seems to be associated with high incidence of lymphatic spread and poor survival in OSCC. CTSK could therefore serve as a predictive biomarker for OSCC. PMID: 29618339
  3. our data showed that elevated Cathepsin K in epithelial ovarian cancer can potentiate the metastasis of epithelial ovarian cancer cells PMID: 29303207
  4. results highlight the possibility that the interaction between GAGs and collagen under acidic conditions has a regulatory impact on cathepsin K-mediated bone degradation. PMID: 29029096
  5. measurement of a periostin fragment resulting from in vivo cathepsin K digestion may help to identify subjects at high risk of fracture. PMID: 28766739
  6. cathepsin K in the development of chronic subdural hematoma PMID: 28887075
  7. Cathepsin K expression within the subchondral bone of the medial tibia plateau was not associated with osteoclast density or symptomatic knee osteoarthritis. PMID: 28087412
  8. The enhanced invasion of carcinomas resulting from cathepsin K overexpression is probably due to the increased cell migration and adhesion. Thus, cathepsin K is implicated not only in protein degradation but also in invasion, migration and adhesion of oral squamous cell carcinomas. PMID: 28117540
  9. positive expression of cathepsin K in melanoma of the skin is associated with other unfavorable prognostic factors PMID: 27709599
  10. Patients affected by castration-resistant prostate carcinoma may be tested for cathepsin K, and a positive strong expression (2+) could be a useful predictive biomarker of response to targeted agents, aiding in the selection of patients eligible for these treatments. PMID: 28085175
  11. Of 160 top compounds tested in enzymatic assays, 28 compounds showed blocking of the collagenase activity of Cathepsin K (CatK) at 100 muM. PMID: 29088253
  12. Cathepsin K cleavage of SDF-1alpha inhibits its chemotactic activity towards glioblastoma stem-like cells. PMID: 28040478
  13. Increased cathepsin K expression in skull base chordoma was associated with tumor invasion and reduced progression free survival. PMID: 28216213
  14. Immunohistochemistry confirmed cathepsin K protein was expressed in lymphangioleiomyomatosis but not control lungs. Cathepsin K gene expression and protein and protease activity were detected in lymphangioleiomyomatosis -associated fibroblasts but not the LAM cell line 621-101. PMID: 28623674
  15. The allosteric site of cathepsin K has been modified by site-directed mutagenesis, and it was shown that it is involved in specific regulation of the collagenolytic activity of cathepsin K. PMID: 27859061
  16. Cathepsin K and osteocalcin plasma levels may be suggested as the significant markers of osteopoenia/osteoporosis. In addition, cathepsin K plasma level can be also a valuable marker of severe Coronary Atherosclerosis and Coronary Artery Calcification . PMID: 26988144
  17. Six mutations in CTSK were identified in 33 families with pycnodysostosis. The high frequency of pycnodysostosis in Ceara State is the consequence of the high inbreeding in that region. PMID: 27558267
  18. The above studies not only demonstrated that CTSK was widely expressed in tooth-related cells (including odonto- clasts, periodontal ligament cells, pulp cells and odonto- blasts), but also indicated that CTSK was closely related to the development of tissues in oral and maxillofacial region as well as occurrence and development of many oral diseases. PMID: 26458004
  19. This mutation (c.480_481insT), (p.L160fsX173) is a novel frameshift mutation. The index case extends the phenotypic spectrum and the list of previously reported mutations in the CTSK gene. PMID: 25304337
  20. There is an increase in levels of CATK in type 1 Gaucher patients compared to the control group. In the patient group, CATK showed higher levels in patients with bone damage compared to those without it. PMID: 25662720
  21. increased expression and activation in osteoarthritis cartilage PMID: 26241216
  22. elevated levels of CatK are closely associated with the presence of chronic heart failure and that the measurement of circulating CatK provides a noninvasive method of documenting and monitoring the extent of chronic heart failure PMID: 26302400
  23. Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model. PMID: 25558848
  24. The study determined almost identical substrate specificities for cysteine cathepsins K, L and S. PMID: 25626674
  25. Matrix-metalloproteinase-9 is cleaved and activated by cathepsin K. PMID: 26219353
  26. Sequence analysis of the patient's CTSK gene revealed homozygosity for a missense mutation (c.746T>C) in exon 6, which leads to amino change (p.Ile249Thr) in the mature CTSK protein PMID: 25725806
  27. The presence of high levels of inactive proforms of cathepsin K in GBM tissues and cells indicate that in GBM the proteolytic/collagenolytic role is not its primary function but it plays rather a different yet unknown role. PMID: 25356585
  28. Two compounds have sizable effects on enzyme activity using interstitial collagen as a natural substrate of cathepsin K and four compounds show a significantly stabilizing effect on cathepsin K. PMID: 25184245
  29. Studies indicate cathepsin X as a target for improving diagnosis and treating cancer patients. PMID: 24835450
  30. SDF-1alpha is involved in homing of CXCR4+ GSLCs and leukocytes and that cathepsin K and osteopontin are involved in the migration of GSLCs out of the niches PMID: 25809793
  31. one cathepsin K molecule binds to collagen-bound glycosaminoglycans at the gap region and recruits a second protease molecule that provides an unfolding and cleavage mechanism for triple helical collagen PMID: 25422423
  32. The identification of CatK exosites opens up the prospect of designing highly potent inhibitors that selectively inhibit the degradation of therapeutically relevant substrates by this multifunctional protease. PMID: 25279554
  33. The data indicated that elevated levels of cathepsin K are closely associated with the presence of CAD and that circulating cathepsin K serves a useful biomarker for CAD. PMID: 24954318
  34. synergism between HIV proteins and pro-atherogenic shear stress to increase endothelial cell expression of the powerful protease cathepsin K PMID: 24719048
  35. Cathepsin K appears to be consistently and strongly expressed in melanocytic lesions and valuable in distinguishing malignant melanomas from the majority of human cancers. PMID: 24696729
  36. results demonstrate that CS plays an important role in contributing to the enhanced efficiency of CatK collagenase activity in vivo PMID: 24958728
  37. identified five CTSK missense mutations (M1I, I249T, L7P, D80Y and D169N), one nonsense mutation (R312X) and one 301 bp insertion in intron 7, which is revealed as Alu sequence; among them, only L7P and I249 were described previously PMID: 24767306
  38. Expression of cathepsins K, S and V within keratinocytes is reduced in photoprotected skin of aged women. PMID: 23871919
  39. The use of exome sequencing in the molecular diagnosis of 2 siblings initially thought to be affected by "intermediate osteopetrosis", which identified a homozygous mutation in the CTSK gene, is described. PMID: 24269275
  40. Data indicate that cathepsin K is expressed in oral tongue squamous cell carcinoma (OTSCC) tissue in both carcinoma and tumor microenvironment (TME) cells. PMID: 23951042
  41. Increased plasma CatK levels are linked with the presence of atrial fibrillation. PMID: 24342995
  42. Skipping of the 121-bp exon 2 results in elimination of the normal start codon and an expected absence of the wild-type CTSK protein. PMID: 24134756
  43. catalase expression (or activity) was higher, while intracellular and extracellular Cat S, Cat L, and Cat K activities were lower in the non-invasive CL1-0 cells compared to the highly invasive CL1-5 cells. PMID: 24583396
  44. Identification of a novel insertional frameshift mutation in exon 4 of the CTSK gene in two families with pycnodysostosis. PMID: 23689398
  45. The basic amino acid clusters in cathepsin K play roles in the formation of collagenolytically active protease complexes. PMID: 24088021
  46. These data indicated that high levels of CatK are closely linked with the presence of coronary artery disease. PMID: 23369704
  47. Our results demonstrate that increased adhesion, migration and invasiveness of tumor cells depend on the inactivation of the tumor suppressive function of profilin 1 by cathepsin X. PMID: 23326535
  48. Cardiac mammalian target of rapamycin and extracellular signal-regulated kinases (ERK) signaling cascades were upregulated by pressure overload, the effects of which were attenuated by cathepsin K knockout. PMID: 23529168
  49. Cathepsin X deficiency leads to a reduced phosphorylation of the IGF-I receptor in response to IGF-I stimulation. PMID: 23152410
  50. show for the first time that bone marrow macrophage-supplied CTSK may be involved in CCL2- and COX-2-driven pathways that contribute to tumor progression in bone PMID: 22614014
  51. Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K. PMID: 22974233
  52. Cathepsin K immunohistochemistry can be helpful in distinguishing alveolar soft part sarcomas and translocation renal cell carcinomas from some but not all of the lesions in their differential diagnosis. PMID: 23355199
  53. Cathepsin S cannibalism of cathepsin K as a mechanism to reduce type I collagen degradation. PMID: 22730330
  54. The exo-peptidase cathepsin X has been identified as a new member of the group of CXCL-12-degrading enzymes secreted by non-hematopoietic bone marrow cells. Cathepsin X can influence hematopoietic stem and progenitor cell trafficking in the bone marrow. PMID: 20494937
  55. the collagenolytic activity of cathepsin K may be increased toward more matured bone collagen. PMID: 22569910
  56. inflammatory cues and monocyte-endothelial cell interactions upregulate cathepsin K and V activity via a JNK signaling axis PMID: 22562303
  57. Data suggest that clusterin increases stability of cathepsin K in dilute/concentrated solutions; clusterin prevents substrate inhibition of cathepsin K; kinetic measurements show that clusterin binds cathepsin K with high affinity. PMID: 22569264
  58. Cathepsin K was found to be constantly and strongly expressed in renal PEComas. PMID: 21874011
  59. Cathepsin K gene expression was found to be significantly greater in more degenerated compared to healthier discs PMID: 21880134
  60. The novel homozygous mutation c.908G>A within exon 8 of the CTSK gene, was identified. PMID: 21099701
  61. Demonstrate here the differential expression of cathepsin K among neoplasms harboring TFE3 gene fusions. PMID: 21602817
  62. Cathepsins K, L, and S activity are profiled in 10 mug human breast, lung, and cervical tumors. PMID: 21756348
  63. Cathepsin K- and L-cleaved chemerin trigger robust migration of human blood-derived plasmacytoid dendritic cells ex vivo PMID: 21715684
  64. serum levels and catios of catK and catL to cysC were not significantly different between patients with coronary artery ectasia and controls PMID: 20837372
  65. a constant and strong expression of cathepsin K in dermatofibroma, but its complete absence in dermatofibrosarcoma protuberans PMID: 20727023
  66. Cath-K represents a sensitive and specific marker to detect and quantitate granulomatous reactions in interstitial lung diseases, and is particularly useful in chronic hypersensitivity pneumonitis cases. PMID: 21086906
  67. A novel missense mutation was identified in CTSK gene in a Pakistani family with 5 individuals affected with autosomal recessive pycnodysostosis. PMID: 20305575
  68. identify and characterize sulfated glycosaminoglycans as natural allosteric modifiers of cathepsin K that exploit the conformational flexibility of the enzyme to regulate its activity and stability against autoproteolysis PMID: 20450492
  69. cleaves kinins and converts angiotensin I to angiotensin II thuys generating hormone peptide receptor agonists PMID: 19800993
  70. Gradual cleavage of LFA-1 by cathepsin X enables the transition between intermediate and high affinity LFA-1 PMID: 19750481
  71. This study demonstrates for the first time a critical role of Cathepsin K in cartilage degradation by synovial fibroblasts (SFs) in rheumatoid arthritis (RA) that is comparable to its well-known activity in osteoclasts. PMID: 11733367
  72. cathepsin K binds with chondroitin sulfate for collagenase activity PMID: 12039963
  73. Selective inhibition of the collagenolytic activity by altering its S2 subsite specificity PMID: 12081494
  74. review discusses the human disease pycnodysostosis caused by cathepsin K deficiency and cathepsin K activity and regulation PMID: 12125807
  75. data suggest that extracellular cysteine proteases may participate in the regulation of kinin levels at inflammatory sites, and clearly support that cathepsin K may act as a potent kininase PMID: 12492488
  76. cathepsin K may have a role in contributing to the invasive potential of prostate cancer PMID: 12568399
  77. In db/db mice, cathepsin k(ctsk) increased, as did Mitf and TFE3, two transcription factors involved in ctsk induction in osteoclasts. Ctsk was increased in other obese models including A(y), fat, and tubby. PMID: 12652657
  78. cathepsin K is capable to degrade aggrecan complexes at specific cleavage sites PMID: 12887056
  79. cathepsin K has a role in lysosomal collagenolytic activity PMID: 14645229
  80. Cathepsin K plays a pivotal role in lung matrix homeostasis under physiological and pathological conditions. PMID: 15161653
  81. These findings suggest that a specific function of human cathepsin X is unlikely to result from sequence specificity, but rather from a combination of its unique positional specificity and the co-localization of enzyme and substrate. PMID: 15737607
  82. heparan sulfate proteoglycans can regulate the cellular trafficking and the enzymatic activity of cathepsin X PMID: 15797245
  83. results support the role of cathepsin K as a major proteinase in osteoclastic bone resorption PMID: 15826870
  84. Several novel ketoamide-based inhibitors of cathepsin K have been identified. PMID: 15837295
  85. Cathepsin X is not involved in degradation of extracellular matrix, a proteolytic event leading to tumor cell invasion and metastasis, and its expression, restricted to immune cells suggests a role in phagocytosis and the regulation of immune response. PMID: 15878337
  86. Cathepsin K co-localized with TRAP in osteoclast-resorptive compartments, supporting a role for cathepsin K in the extracellular processing of monomeric TRAP in the resorption lacuna. PMID: 15929988
  87. Osteoblastic cathepsin K may thus contribute to collagenous matrix maintenance and recycling of improperly processed collagen I PMID: 16337236
  88. The presence of active cathepsins L, K and S suggests that they contribute to the extracellular breakdown of the extracellular matrix. PMID: 16354158
  89. Active cathepsin X mediates the function of beta(2) integrin receptors during cell adhesion and that it could also be involved in other processes associated with beta(2) integrin receptors such as phagocytosis and T cell activation. PMID: 16774752
  90. Cathepsin K is essential for normal bone resorption (review) PMID: 16831915
  91. CTSK may be involved in the pathogenesis of obesity by promoting adipocyte differentiation. PMID: 16912123
  92. Possiable role in homeostasis of dermal extracellular matrix and dynamic equilibrium between matrix synthesis and proteolytic degradation, by counteracting deposition of matrix proteins during scar formation with its matrix-degrading activity. PMID: 16946716
  93. analysis of human cathepsins K, L, and S iunteractions with elastins PMID: 17227755
  94. Cathepsin K is constitutively expressed in normal human brain, and is alterated in its expression inscizophrenia. PMID: 17230547
  95. molecular characterization of 12 unrelated patients with Pycnodysostosis; mutational profile consisted of 12 different mutations, including nine previously unreported ones PMID: 17397052
  96. Cathepsin K expression is of predictive prognostic value for patients with high-grade osteosaromas and metastasis at diagnosis. PMID: 17683065
  97. In breast cancer patients, cathepsin K serum levels were significantly lower than in sex matched control group or in patients with primary osteoporosis PMID: 17728092
  98. in peri-and postmenopausal women, moderate negative correlation of serum cathepsin K levels with change in femoral neck BMD, but none with change in spinal BMD was found PMID: 17882010
  99. Induction of cathepsin K is associated with the activation of protein p38 MAP kinase. PMID: 17991740
  100. Myeloma-osteoclast interactions stimulated the production of TRAP, cathepsin K, MMP-1, -9, and uPA PMID: 18053985

Show More

Hide All

Involvement in disease Pycnodysostosis (PKND)
Subcellular Location Lysosome
Protein Families Peptidase C1 family
Tissue Specificity Predominantly expressed in osteoclasts (bones).
Database Links

HGNC: 2536

OMIM: 265800

KEGG: hsa:1513

STRING: 9606.ENSP00000271651

UniGene: Hs.632466

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1