Recombinant Human Cathepsin K(CTSK)

Code CSB-YP006192HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P43235
Relevance Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cathepsin OCathepsin O2;Cathepsin X
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Research Area Signal Transduction
Source Yeast
Gene Names CTSK
Protein Names Recommended name: Cathepsin K EC= 3.4.22.38 Alternative name(s): Cathepsin O Cathepsin O2 Cathepsin X
Expression Region 115-329aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Involvement in disease Pycnodysostosis (PKND)
Subcellular Location Lysosome
Protein Families Peptidase C1 family
Tissue Specificity Predominantly expressed in osteoclasts (bones).
Database Links

HGNC: 2536

OMIM: 265800

KEGG: hsa:1513

STRING: 9606.ENSP00000271651

UniGene: Hs.632466

Pathway Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway

Related Products

CTSK Antibodies

CTSK Antibodies for Homo sapiens (Human)

CTSK Antibodies for Human

CTSK Proteins

CTSK Proteins for Homo sapiens (Human)

CTSK ELISA Kit

CTSK ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.