Recombinant Human Cell division cycle protein 20 homolog (CDC20)

In Stock
Code CSB-EP623655HU
Abbreviation Recombinant Human CDC20 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
p55CDC
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-499aa
Target Protein Sequence
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process for producing recombinant Human CDC20 protein in e.coli cells follows a sequence of steps: creating the expression vector that codes for the Human CDC20 protein (1-499aa), introducing it into e.coli cells, cultivating and inducing of positive cells for protein expression, lysing cells, and conducting expression analysis. The resultant recombinant Human CDC20 protein is purified from the cell lysate using affinity purification, with its purity exceeding 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Gene References into Functions
  1. we demonstrate that the CDC20-MAD2 complex could also be formed independently of the SAC. Moreover, in prolonged arrest caused by nocodazole treatment, the overall levels of the CDC20-MAD2 complex are gradually, but significantly, reduced and this is associated with lower levels of cyclin B1, which brings a new insight into the mechanism of mitotic "slippage" of the arrested cells. PMID: 28112196
  2. Cdc20 may be a promising molecular target for chemotherapy. PMID: 29901174
  3. Long non-coding RNA SPRY4-IT1 promotes cell proliferation and invasion by regulation of Cdc20 in pancreatic cancer cells PMID: 29489909
  4. Cdc20 functions as an important negative regulator of SMAR1 in higher grades of cancer PMID: 28617439
  5. Data provide support for the recent structure-based models and functionally dissect three elements of Cdc20 inhibition: sequestration of Cdc20 in the core mitotic checkpoint complex, sufficient at low Cdc20 concentrations; inhibition of a second Cdc20 through the Mad3 C terminus, independent of Mad2 binding to this Cdc20 molecule; and occupancy of the APC/C with full MCC, where Mad3 and Apc15 are involved. PMID: 28366743
  6. CDC20 gene, related to cell proliferation in protein complex A, might play momentous roles in the initiation and development of consecutive Trauma-Induced Sepsis. PMID: 29642183
  7. A mitotic phosphorylation site on Cdc20, known to be a substrate of PP2A(B56), modulates APC/C(Cdc20) assembly. PMID: 28404789
  8. c-Myc is a driver when combined with kRas/Akt3 oncogenic signals in gliomagenesis, whereas Cdc20 overexpression is a passenger PMID: 26993778
  9. The ABBA-KEN-ABBA amino acid motif cassette holds the Mitotic Checkpoint Complex (MCC) onto the Anaphase-Promoting Complex-Cyclosome (APC/C) by binding the two Cdc20 molecules in the MCC-APC/C complex. PMID: 27939943
  10. It discuses the roles of Cdc20 in SAC signalling and mitotic exit, describe how the integration of traditional approaches with emerging technologies has revealed new details of Cdc20 functions, comment about the potential of Cdc20 as a therapeutic target for the treatment of human malignancies. PMID: 28202332
  11. Prostate cancer-derived SPOP mutants failed to interact with Cdc20 to promote its degradation. As a result, SPOP-deficient prostate cancer cells with elevated Cdc20 expression became resistant to a pharmacological Cdc20 inhibitor. PMID: 27780719
  12. High CDC20 expression is associated with metastatic castration-resistant prostate cancer growth and reduces chemosensitivity . PMID: 27633058
  13. These results provide novel insight into the mechanisms underlying the aberrant capability of NUP98 oncoproteins to interact with APC/C(Cdc20) and to interfere with its function. PMID: 27097363
  14. In lung adenocarcinoma patients, overexpression of cell division cycle 20 was significantly associated with bigger primary tumor size, higher MKI67 level, higher DNA ploidy level, and poor prognosis. PMID: 28349831
  15. CDC20 may have a role in carcinoma of the breast, colon, endometrium, and prostate PMID: 26245990
  16. Overexpression of Cdc20 may serve as an independent predictor for biochemical recurrence in patients of clinically localized prostate cancer undergoing laparoscopic radical prostatectomy without neoadjuvant therapy. PMID: 26889981
  17. Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1. PMID: 26626260
  18. The presence of this segment correlates with SAC activity and efficient binding of CDC20 but not of MAD1 to kinetochores. PMID: 26148513
  19. These results suggest CDC20 is a critical regulator of TIC proliferation and survival, linking two key TIC nodes-FOXM1 and p21CIP1/WAF1-elucidating a potential point for therapeutic intervention. PMID: 25938542
  20. CDC20 is essential for the in vivo tumorigenicity of glioblastoma stem-like cells. CDC20 is prognostic of overall survival in Proneural subtype glioblastoma patients. PMID: 26074073
  21. spindle checkpoint release further increases APC/C(Cdc20) catalytic activity PMID: 25673878
  22. CDC20, MAD2 and Aurora-B protein expression are associated with chromosomal abnormalities and poor prognosis in patients with myelodysplastic syndromes. PMID: 25637637
  23. Results show that increased expression of CDC20 was demonstrated to be associated with the development and progression of hepatocellular carcinoma. PMID: 25069850
  24. The master cell cycle regulator Cdc20 regulates ciliary length and disassembly of the primary cilium. PMID: 25139956
  25. the mitotic checkpoint complex (MCC) can inhibit a second CDC20 that has already bound and activated the APC/C; the MCC inhibits active APC/C and this is essential for the spindle assembly checkpoint PMID: 25383541
  26. MAD2 and CDC20 overexpression was increased in high-grade squamous intraepithelial lesions and squamous cell carcinomas, suggesting their involvement in the initiation of cervical cancers. PMID: 25083970
  27. excess E2F1 due to Rb inactivation recruits the complex of Cdc20 and the anaphase-promoting complex/cyclosome to deregulate the expression of UBCH10 PMID: 25368385
  28. IR motif integrity is particularly important for stable binding to the APC/C. PMID: 24464857
  29. CDC20 upregulation was associated with aggressive progression and poor prognosis in gastric cancer. PMID: 24551295
  30. high Cdc20 and securin immunoexpression identified a patient subgroup with extremely short, on average 2.4 years, breast cancer survival and triple-negative breast cancer subtype. PMID: 24853182
  31. Mad2, the kinetochore localization of Cdc20, is disrupted in Chk1 depleted cells. PMID: 24747134
  32. These results reveal an important role for APC(Cdc20) in governing apoptosis, strengthening the rationale for developing specific Cdc20 inhibitors as effective anticancer agents. PMID: 24871945
  33. CDC20 is increased in patients with colorectal cancer with poor prognosis PMID: 23758705
  34. increased expression of CDC20 and MAD2 is related to poor prognosis of urothelial carcinoma of the human bladder PMID: 23995871
  35. PHF8 is regulated by APC(cdc20) and plays an important role in the G2/M transition. PMID: 23979597
  36. Geminin is a target of the spindle checkpoint and APC/C(Cdc20). PMID: 23775192
  37. phosphorylation on CRY-box by Polo-like kinase-1 is required for Cdh1-dependent degradation of Cdc20 during somatic cell cycle PMID: 23643811
  38. High CDC20 expression is associated with cervical cancer. PMID: 23405241
  39. Nek2A binds with high affinity to apo-APC/C and is degraded by the pool of Cdc20 that avoids inhibition by the spindle assembly checkpoint. PMID: 23288039
  40. The crystal structures of human Cdc20 alone or bound to a BubR1 KEN box, is reported. PMID: 23091007
  41. APC/C(Cdc20) or APC/C(Cdh1) complexes regulate RAP80 stability during mitosis to the G(1) phase, and these events are critical for a novel function of RAP80 in mitotic progression. PMID: 22426463
  42. Data identify Cdc20, USP44, and Wee1 as relevant Fcp1 targets. PMID: 22692537
  43. Aberrant CDC20 expression may play an important role in pancreatic ductal adenocarcinoma tumorigenesis and progression and may thus be useful as a marker of disease progression and prognosis and as a therapeutic target. PMID: 22475564
  44. CDC20-mediated degradation of conductin regulates Wnt/beta-catenin signalling for maximal activity during G1/S. PMID: 22322943
  45. The binding of p31(comet) to Mad2 in the mitotic checkpoint complex may trigger a conformational change in Cdc20 that facilitates its phosphorylation by Cdk, and that the latter process may promote its dissociation from BubR1. PMID: 22566641
  46. both p31(comet) and ubiquitination of Cdc20 are critical mechanisms of checkpoint inactivation. They act redundantly to promote Mad2 dissociation from Cdc20. PMID: 21937719
  47. These findings expand our knowledge of both Sp100 and Cdc20 as well as their role in ubiquitination. PMID: 22086178
  48. Anaphase promoting complex subunit 15(APC15) mediates the constant turnover of CDC20 and mitotic checkpoint protein complexes, allowing the spindle checkpoint assembly to respond to the attachment state of kinetochores. PMID: 21926987
  49. Spindle assembly checkpoint protein Cdc20 transcriptionally activates expression of ubiquitin carrier protein UbcH10. PMID: 21454660
  50. These data suggest that APC/C(Cdc20) specifically targets E2F1 for degradation in early mitosis and reveal a novel mechanism for limiting free E2F1 levels in cells, failure of which may compromise cell survival and/or homeostasis. PMID: 20948288

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
Protein Families
WD repeat CDC20/Fizzy family
Database Links

HGNC: 1723

OMIM: 603618

KEGG: hsa:991

STRING: 9606.ENSP00000308450

UniGene: Hs.524947

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*