Recombinant Human Centromere protein H (CENPH)

Code CSB-EP005211HU
Abbreviation Recombinant Human CENPH protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CENPH
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
CENP H; CENP-H; CENPH; CENPH_HUMAN; Centromere protein H; ICEN35; Interphase centromere complex protein 35; Kinetochore protein CENP H; NNF1; NNF1; MIND kinetochore complex component; homolog; PMF1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-247aa
Target Protein Sequence
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.5kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.
Gene References into Functions
  1. In summary, CENP-H may be involved in cell proliferation and apoptosis of hepatocellular carcinoma (HCC)cells through the mitochondrial apoptotic pathway. Combined with previous studies, the data provide a new perspective on HCC development and progression. PMID: 28498417
  2. Upregulation of centromere protein H is associated with progression of renal cell carcinoma PMID: 26248586
  3. propose that CSPP1 cooperates with CENP-H on kinetochores to serve as a novel regulator of kinetochore microtubule dynamics for accurate chromosome segregation PMID: 26378239
  4. CENP-H was overexpressed in HCC, and its level of upregulation was an independent prognostic indicator, suggesting that CENP-H may be an effective therapeutic strategy for the treatment of HCC. PMID: 23970101
  5. CENP-H promotes the proliferation of human gastric cancer cells PMID: 22381774
  6. High expression of CENP-H in gastric cancer indicates poor prognosis and Survivin may mediate its procancer role. PMID: 22999412
  7. Breast cancer patients with high CENP-H expression had short overall survival. CENP-H expression was related with clinical stage. PMID: 21880184
  8. upregulated CENP-H and Ki67 levels are significantly associated with short relapse-free survival in hypopharyngeal squamous cell carcinoma (HSSC); these factors may be predictors of a relapsing phenotype in HSSC cases PMID: 22631655
  9. Sp1 and Sp3 bind to the CENPH minimal promoter and function as a regulator of the transcription of CENPH in nasopharyngeal carcinomas. PMID: 22682030
  10. CENP-H is up-regulated and plays an important role in the aneuploidy frequently observed in colorectal cancers. PMID: 15930286
  11. The CENP-H-I complex may function, in part, as a marker directing CENP-A deposition to centromeres. PMID: 16622420
  12. has an important impact on the architecture and function of the human kinetochore complex PMID: 16875666
  13. CENP-H has a role in preventing progression of nasopharyngeal carcinoma PMID: 17255272
  14. CENP-C and CENP-H co-localize to the CENP-A chromatin domain. PMID: 17651496
  15. CENP-H protein has a role in esophageal carcinoma progression PMID: 18700042
  16. expression of CENPH was much higher in cancer cell lines & lung cancer tissue than normal cells & adjacent noncancerous lung tissues; results show that high CENPH protein expression was related to poor outcome in patients with nonsmall cell lung cancer PMID: 19170237
  17. TRIM36 has a ubiquitin ligase activity and interacts with centromere protein-H. PMID: 19232519
  18. Upregulation of CENP-H in tongue cancer is associated with disease progression. PMID: 19500341
  19. CENP-H-containing complex facilitates deposition of newly synthesized CENP-A into centromeric chromatin in cooperation with FACT and CHD1. PMID: 19625449

Show More

Hide All

Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Note=Associates with active centromere-kinetochore complexes throughout the cell cycle. Colocalizes with inner kinetochore plate proteins CENPA and CENPC during both interphase and metaphase.
Protein Families
CENP-H/MCM16 family
Database Links

HGNC: 17268

OMIM: 605607

KEGG: hsa:64946

STRING: 9606.ENSP00000283006

UniGene: Hs.631967

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*