Recombinant Human Chemokine-like receptor 1 (CMKLR1), partial

Code CSB-EP005614HU1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CMKLR1
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
321-373aa
Target Protein Sequence
QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
41.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 initiates activation of G proteins G(i)/G(o) and beta-arrestin pathways inducing cellular responses via second messenger pathways such as intracellular calcium mobilization, phosphorylation of MAP kinases MAPK1/MAPK3 (ERK1/2), TYRO3, MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis PubMed:27716822. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF-kappa-B. Positively regulates adipogenesis and adipocyte metabolism.; (Microbial infection) Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2).
Gene References into Functions
  1. levels in cord blood, peripheral blood, adipose tissue and placenta tissue significantly higher in gestational diabetes PMID: 29430984
  2. CMKLR1 and GPR1 were widely expressed in vascular smooth muscle. PMID: 27742615
  3. Both ALX and ChemR23 were present in human synovium and medial tibial plateau bone obtained following total knee replacement surgery for osteoarthritis. PMID: 27860453
  4. Results show that ChemR23 is highly expressed in squamous oesophageal cancer tumors and cell lines. PMID: 27092781
  5. CMKLR1 exacerbated the proliferation and migration of VSMCs by activating ERK1/2. PMID: 27792688
  6. We demonstrated that chemerin is linked to metabolic syndrome components. Moreover, serum chemerin levels were associated significantly with obesity, especially visceral adipose tissue, in subjects with T2DM [type 2 diabetes mellitus]. PMID: 28120562
  7. Study shows that hepatic CMKLR1 mRNA is weakly associated with features of NASH in male patients only. PMID: 27548138
  8. Our results show that higher levels of circulating chemerin, CRP, fibrinogen, and ESR are associated with an increased risk of developing colorectal cancer PMID: 26628300
  9. Data show inverse Relationship of the CMKLR1 Relative Expression and Chemerin Serum Levels in Obesity with Dysmetabolic Phenotype and Insulin Resistance PMID: 27239101
  10. Results indicate that Abeta42 activates CMKLR1, leading to glia cell migration and clearance of Abeta42; and is involved in Abeta processing and clearance PMID: 25079809
  11. Gestational obesity and gestational diabetes mellitus may contribute to elevated serum chemerin. Serum chemerin in pregnancy was associated with insulin resistance and triglycerides. Chemerin gene may play a role both in obese and gestational diabetes mellitus patients PMID: 25627894
  12. Increased chemerin expression in dermal blood vessels may be associated with the development of digital ulcers in systemic sclerosis. PMID: 25539827
  13. The study for the first time confirmed a marked expression of chemerin and CMKLR1 in the liver of chronic hepatitis patients. PMID: 25121101
  14. ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages. PMID: 25637017
  15. The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported. PMID: 25030943
  16. Results lend some support to a presumable role of locally produced chemerin in the progression of atherosclerotic lesions, possibly acting through its CMKLR1 receptor. PMID: 24779513
  17. This study identified the up-regulation of ChemR23 in post-traumatic injury of calcaneal articular fracture PMID: 24689495
  18. ChemR23 is expressed in neutrophil granules and rapidly upregulated upon neutrophil activation. PMID: 23999103
  19. Development of a membrane-anchored chemerin receptor agonist as a novel modulator of allergic airway inflammation and neuropathic pain. PMID: 24659779
  20. Chemerin receptor showed increased expression in the lymph nodes and the spleen. PMID: 23904282
  21. Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1. PMID: 23495698
  22. review of current research on biological roles of chemerin and chemokine-like receptor 1; highlight roles in mediating obesity and development of type 2 diabetes [REVIEW] PMID: 22610747
  23. The interaction of chemerin and ChemR23 may play an important role in the pathogenesis of rheumatoid arthritis through the resultant activation of fibroblast-like synoviocytes. PMID: 21959042
  24. These results rule out the direct anti-inflammatory effect of chemerin on macrophages ex vivo, described previously in the literature, despite the expression of a functional ChemR23 receptor in these cells. PMID: 22768214
  25. Chemerin, a ligand for the G-protein coupled receptor chemokine-like receptor 1, requires carboxy-terminal proteolytic processing to unleash its chemoattractant activity PMID: 21715684
  26. The ChemR23/Chemerin axis may have a role in the recruitment of dendritic cells within the kidney in patients affected by lupus nephritis. PMID: 21346723
  27. A genetic variation in the chemokine-like receptor 1 (CMKLR1) gene was statistically significantly associated with decreased overall survival in the three individual populations as well as in pooled analyses. PMID: 21483023
  28. These results demonstrate that human chondrocytes express both the receptor ChemR23 and the ligand chemerin...which may play pivotal roles in joint inflammation. PMID: 21192818
  29. the presence of ChemR23 in human endothelial cells, its significant up-regulation by pro-inflammatory cytokines, and its role in angiogenesis were demonstrated. PMID: 20044979
  30. RvE1 initiates direct activation of ChemR23 and signals receptor-dependent phosphorylation PMID: 19906641
  31. ChemR23 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB PMID: 15753205
  32. The results strongly support that the chemerin receptor, in the presence of CD4, functions as a "minor co-receptor" promoting infection by HIV-1, HIV-2 and SIV. PMID: 16904155
  33. CMKLR1 is expressed by circulating pDC in normal individuals and patients suffering from skin diseases, such as psoriasis and atopic dermatitis. PMID: 19168032

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Prominently expressed in developing osseous and cartilaginous tissue. Also found in adult parathyroid glands. Expressed in cardiovascular system, brain, kidney, gastrointestinal tissues and myeloid tissues. Expressed in a broad array of tissues associated
Database Links

HGNC: 2121

OMIM: 602351

KEGG: hsa:1240

STRING: 9606.ENSP00000311733

UniGene: Hs.197143

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*